DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and ZNF331

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	NP_001073375.1	Gene:	ZNF331 / 55422	HGNCID:	15489	Length:	463	Species:	Homo sapiens

Alignment Length:	121	Identity:	45/121 - (37%)
Similarity:	62/121 - (51%)	Gaps:	13/121 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            ||:.|.|.  :|.|.:::...|..|.|.|.|||||.|.  ||...|.....|.:|||.|:|.|||
Human   239 GEKDYECK--DCGKTFSRVYKLIQHKRIHSGEKPYECK--DCGKAFICGSSLIQHKRIHTGEKPY 299

  Fly   258 KCDYCSKCFARSDHLTKHRKVHE-------RRLLAASRAGRSLISDDLYAVRPGRK 306
            :|..|.|.|.|.::||:|:|:|.       :....|.|.|.||:..:  .:..|.|
Human   300 ECQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHE--RIHTGEK 353

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	33/78 (42%)
		C2H2 Zn finger	203..221	CDD:275368	5/17 (29%)
		C2H2 Zn finger	229..251	CDD:275368	8/21 (38%)
		zf-H2C2_2	243..268	CDD:290200	13/24 (54%)
		C2H2 Zn finger	259..279	CDD:275368	9/19 (47%)
ZNF331	NP_001073375.1	KRAB	5..46	CDD:366587
		COG5048	<32..284	CDD:227381	19/48 (40%)
		C2H2 Zn finger	133..153	CDD:275368
		C2H2 Zn finger	161..181	CDD:275368
		COG5048	185..441	CDD:227381	45/121 (37%)
		C2H2 Zn finger	189..209	CDD:275368
		C2H2 Zn finger	217..237	CDD:275368
		C2H2 Zn finger	245..265	CDD:275368	6/21 (29%)
		C2H2 Zn finger	273..293	CDD:275368	8/21 (38%)
		C2H2 Zn finger	301..321	CDD:275368	9/19 (47%)
		C2H2 Zn finger	329..349	CDD:275368	5/21 (24%)
		C2H2 Zn finger	357..377	CDD:275368
		C2H2 Zn finger	385..405	CDD:275368
		C2H2 Zn finger	413..433	CDD:275368
		C2H2 Zn finger	441..461	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000