Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005173612.1 | Gene: | osr2 / 550389 | ZFINID: | ZDB-GENE-050417-183 | Length: | 278 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 57/199 - (28%) |
---|---|---|---|
Similarity: | 79/199 - (39%) | Gaps: | 42/199 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 IDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDF-------LPERTPLCTDNCADFLEESNSNLRL 149
Fly 150 SG----PPHSEIFVPDRSSSSPGSSDSASPAEAVAPPSALQMSENAAGERGYLCTFGNCEKIYAK 210
Fly 211 PAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKH 275
Fly 276 RKVH 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 30/78 (38%) |
C2H2 Zn finger | 203..221 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 229..251 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 243..268 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 259..279 | CDD:275368 | 7/19 (37%) | ||
osr2 | XP_005173612.1 | COG5048 | <55..>276 | CDD:227381 | 54/189 (29%) |
C2H2 Zn finger | 136..156 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 148..173 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 164..184 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 176..199 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 192..212 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 218..240 | CDD:278523 | |||
C2H2 Zn finger | 220..240 | CDD:275368 | |||
C2H2 Zn finger | 248..268 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |