DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and osr2

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_005173612.1 Gene:osr2 / 550389 ZFINID:ZDB-GENE-050417-183 Length:278 Species:Danio rerio


Alignment Length:199 Identity:57/199 - (28%)
Similarity:79/199 - (39%) Gaps:42/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDF-------LPERTPLCTDNCADFLEESNSNLRL 149
            :..|..||..|.|    |.|.|  ...|..:.|       ||.:.|:...:...|   ..:||.:
Zfish    45 VQMNRWTVGFPQL----QGLAD--PRFPGALPFPAAAAHLLPHKHPVHRKDRPRF---DFANLAV 100

  Fly   150 SG----PPHSEIFVPDRSSSSPGSSDSASPAEAVAPPSALQMSENAAGERGYLCTFGNCEKIYAK 210
            :.    ||     |..:|..||    ...||....|         |..::.::|.|  |.:.:.|
Zfish   101 AATQEDPP-----VTGQSRLSP----ERRPARGRLP---------AKSKKEFICRF--CGRHFTK 145

  Fly   211 PAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKH 275
            ..:|..|.|.|..|:||.|.  .|...|.|.|.|..|:..||..||:||..|.|.|.:|..|..|
Zfish   146 SYNLLIHERTHTDERPYTCD--ICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVH 208

  Fly   276 RKVH 279
            :.:|
Zfish   209 KTLH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 30/78 (38%)
C2H2 Zn finger 203..221 CDD:275368 5/17 (29%)
C2H2 Zn finger 229..251 CDD:275368 7/21 (33%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
osr2XP_005173612.1 COG5048 <55..>276 CDD:227381 54/189 (29%)
C2H2 Zn finger 136..156 CDD:275368 7/21 (33%)
zf-H2C2_2 148..173 CDD:290200 10/26 (38%)
C2H2 Zn finger 164..184 CDD:275368 7/21 (33%)
zf-H2C2_2 176..199 CDD:290200 10/22 (45%)
C2H2 Zn finger 192..212 CDD:275368 7/19 (37%)
zf-C2H2 218..240 CDD:278523
C2H2 Zn finger 220..240 CDD:275368
C2H2 Zn finger 248..268 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.