DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and sp2

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_031749963.1 Gene:sp2 / 549560 XenbaseID:XB-GENE-968274 Length:588 Species:Xenopus tropicalis


Alignment Length:181 Identity:59/181 - (32%)
Similarity:88/181 - (48%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VEIPDLVDFLPERTPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDRSSSSPGSSDSASPAE--- 177
            :::|..:...|.:..|...|.      |:.|:.:||...|:|    :.......|....|.|   
 Frog   418 MQMPVTITSTPGQPQLSVQNV------SSGNVAISGLSPSQI----QLQMEQALSGELQPGEKRR 472

  Fly   178 --AVAPPSALQMSENAAGERG---------YLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSW 231
              |...|:...      ||:|         ::|....|.:.:.|.:.|:||:|.|.||:|:||:|
 Frog   473 RVACTCPNCKD------GEKGRWGPPGRKRHVCHIPECGRTFRKTSLLRAHVRLHTGERPFVCNW 531

  Fly   232 PDCVWRFSRSDELARHKRSHSGV---KPYKCDYCSKCFARSDHLTKHRKVH 279
            ..|..||:|||||.||.|:|:||   |.::|..|.|.|.||||::||.|.|
 Frog   532 GFCTKRFTRSDELQRHARTHTGVTGDKRFECPQCQKRFTRSDHVSKHFKTH 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 39/81 (48%)
C2H2 Zn finger 203..221 CDD:275368 6/17 (35%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 13/27 (48%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)
sp2XP_031749963.1 SP2_N 27..498 CDD:411776 18/95 (19%)
C2H2 Zn finger 502..521 CDD:275368 6/18 (33%)
zf-H2C2_2 514..540 CDD:404364 14/25 (56%)
C2H2 Zn finger 529..551 CDD:275368 13/21 (62%)
zf-H2C2_2 543..571 CDD:404364 13/27 (48%)
C2H2 Zn finger 562..582 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.