Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006079.1 | Gene: | osr1 / 450059 | ZFINID: | ZDB-GENE-070321-1 | Length: | 264 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 63/250 - (25%) |
---|---|---|---|
Similarity: | 92/250 - (36%) | Gaps: | 68/250 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 TNGNIQVGLPHVEDPSLFIDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCAD 138
Fly 139 FLEESNSNLRLSGPPHSEIFVP-DRSSSSPGSS---------DSASPAEAVAPPSALQ---MSEN 190
Fly 191 -------------------------------AAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGE 224
Fly 225 KPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 30/78 (38%) |
C2H2 Zn finger | 203..221 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 229..251 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 243..268 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 259..279 | CDD:275368 | 7/19 (37%) | ||
osr1 | NP_001006079.1 | zf-C2H2 | 174..196 | CDD:278523 | 7/23 (30%) |
C2H2 Zn finger | 176..196 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 188..213 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 204..224 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 216..239 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 232..252 | CDD:275368 | 7/19 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |