Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262902.1 | Gene: | Spps / 42882 | FlyBaseID: | FBgn0039169 | Length: | 985 | Species: | Drosophila melanogaster |
Alignment Length: | 334 | Identity: | 90/334 - (26%) |
---|---|---|---|
Similarity: | 123/334 - (36%) | Gaps: | 132/334 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 SNNNTNTNGNIQVGLPHVEDPSLFIDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLP------ 126
Fly 127 ERTPLCTDNCAD-------FLE-ESNSNLRLSGPPHSEI-FVPDRSSSSPGSSDSASPAE----- 177
Fly 178 --------------AVAP-------------------------------PSALQMSEN------- 190
Fly 191 ----------AAGE-------------------------RGYLCTFGNCEKIYAKPAHLKAHLRR 220
Fly 221 HLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLA 285
Fly 286 ASRAGRSLI 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 44/78 (56%) |
C2H2 Zn finger | 203..221 | CDD:275368 | 10/17 (59%) | ||
C2H2 Zn finger | 229..251 | CDD:275368 | 14/21 (67%) | ||
zf-H2C2_2 | 243..268 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 259..279 | CDD:275368 | 12/19 (63%) | ||
Spps | NP_001262902.1 | COG5048 | <725..827 | CDD:227381 | 48/106 (45%) |
C2H2 Zn finger | 742..764 | CDD:275368 | 11/21 (52%) | ||
zf-H2C2_2 | 756..783 | CDD:290200 | 17/26 (65%) | ||
C2H2 Zn finger | 772..794 | CDD:275368 | 14/21 (67%) | ||
zf-H2C2_2 | 786..809 | CDD:290200 | 11/22 (50%) | ||
zf-C2H2 | 800..822 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 802..822 | CDD:275368 | 12/19 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23235 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |