DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Spps

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster


Alignment Length:334 Identity:90/334 - (26%)
Similarity:123/334 - (36%) Gaps:132/334 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SNNNTNTNGNIQVGLPHVEDPSLFIDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLP------ 126
            |:....|.|.:|| :|..|..|.......:...|||                   .|.|      
  Fly   524 SHPQVQTQGQVQV-MPKQEPQSPTQMITSIKQEPPD-------------------TFGPISATGN 568

  Fly   127 ERTPLCTDNCAD-------FLE-ESNSNLRLSGPPHSEI-FVPDRSSSSPGSSDSASPAE----- 177
            ...|..|.|.|.       ||. ||||...||.|...:| .:|.:::::|.:..:..|..     
  Fly   569 PPAPASTPNTASPQQQQIKFLHTESNSLSSLSIPASIQITALPQQATNTPNTPATTQPIPVSLPA 633

  Fly   178 --------------AVAP-------------------------------PSALQMSEN------- 190
                          .:||                               ||...::.|       
  Fly   634 RSKVNAVTTSSTQITIAPTGGQVVSVTTQARGATASIRSTNTSTTTITTPSQSHLNMNISVASVG 698

  Fly   191 ----------AAGE-------------------------RGYLCTFGNCEKIYAKPAHLKAHLRR 220
                      |.||                         |.::|....|.|:|.|.:||:||||.
  Fly   699 GAATGGGGGTATGEPKPRLKRVACTCPNCTDGEKHSDKKRQHICHITGCHKVYGKTSHLRAHLRW 763

  Fly   221 HLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLA 285
            |.||:|:||||..|..||:|||||.||:|:|:|.|.::|..|:|.|.|||||:||.|.|.:    
  Fly   764 HTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTHFK---- 824

  Fly   286 ASRAGRSLI 294
             ||:|..||
  Fly   825 -SRSGVELI 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 12/24 (50%)
C2H2 Zn finger 259..279 CDD:275368 12/19 (63%)
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 48/106 (45%)
C2H2 Zn finger 742..764 CDD:275368 11/21 (52%)
zf-H2C2_2 756..783 CDD:290200 17/26 (65%)
C2H2 Zn finger 772..794 CDD:275368 14/21 (67%)
zf-H2C2_2 786..809 CDD:290200 11/22 (50%)
zf-C2H2 800..822 CDD:278523 12/21 (57%)
C2H2 Zn finger 802..822 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.