DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and dar1

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster


Alignment Length:363 Identity:96/363 - (26%)
Similarity:124/363 - (34%) Gaps:123/363 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GDALLNIVSVGEFDSTYVD--TSFSGGNYNQLEFEESDYYGIITLDSNNNTNTNGNIQVGLPHVE 86
            ||   |..:...:...|..  .|.|||.|  |....|:.|| .:..|:.:.:|...|       .
  Fly   400 GD---NSGNTSSYQQQYASQLVSGSGGGY--LNGSSSNSYG-YSWHSSQSFHTKYQI-------H 451

  Fly    87 DPSLFIDFNDLTVCPP--DLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADFLEESNSNLRL 149
            .||............|  .|...:|:......::..|.......||..:.:.......|:::..:
  Fly   452 PPSAAASATASATATPTAQLGAQQQQQQQQQQQLQQLCPPAAPSTPSTSSSSISSSSASSASRHM 516

  Fly   150 SGPPHSEIFVPDRSSSSPGSSDSASPAEAVA--------------------PPSALQMSENAA-- 192
            ..||   :..|.....|||||..|:.|.|.|                    ||..||:...||  
  Fly   517 FVPP---LTPPSSDPGSPGSSMVAAAAAAAAQRRTTPPPPYQQGHVMGLINPPPTLQLLGGAATG 578

  Fly   193 --------------------------------------------GERG----------------- 196
                                                        |.||                 
  Fly   579 SNNSCTTTLTTLTPASAIQQQQQQPQQQQVPQQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLM 643

  Fly   197 --------------------YLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRS 241
                                :.|.|..|.|:|.|.:|||||.|.|.|||||.|.||:|.|||:||
  Fly   644 SVRTVRYNRRNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARS 708

  Fly   242 DELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |||.||.|.|:|.||:||..|.:.|||||||..|.|.|
  Fly   709 DELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRH 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 48/78 (62%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 15/21 (71%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 36/82 (44%)
C2H2 Zn finger 671..688 CDD:275368 10/16 (63%)
zf-H2C2_2 680..707 CDD:290200 19/26 (73%)
C2H2 Zn finger 696..718 CDD:275368 15/21 (71%)
zf-H2C2_2 710..735 CDD:290200 13/24 (54%)
C2H2 Zn finger 726..746 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455417
Domainoid 1 1.000 40 1.000 Domainoid score I3723
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.