DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf15

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_997911.2 Gene:klf15 / 335901 ZFINID:ZDB-GENE-030131-7844 Length:442 Species:Danio rerio


Alignment Length:183 Identity:75/183 - (40%)
Similarity:96/183 - (52%) Gaps:46/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PPHSEIFVPDRSSSSPGSSDSASPAEAVAPPSALQ--------------------MSENAAGE-- 194
            ||.|:|.:.....:..|.:.:..|  .|.||::|.                    :.||..|:  
Zfish   262 PPASDIKIAQLLVNIQGQTFALVP--QVIPPASLNNSSSKFVRIAPVPIAAKPLGLGENGTGDGQ 324

  Fly   195 --------------------RGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFS 239
                                :.:.|||..|.|:|.|.:|||||||||.|||.:.|:||.|.||||
Zfish   325 GTGLVVGGHKFQKSLVADLIKMHKCTFPGCAKMYTKSSHLKAHLRRHTGEKLFACTWPGCDWRFS 389

  Fly   240 RSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLAASRAGRS 292
            |||||:||:|||||||||:|..|.|.|||||||:||.|||  |...:||..|:
Zfish   390 RSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVH--RFPRSSRTART 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 55/78 (71%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 16/21 (76%)
zf-H2C2_2 243..268 CDD:290200 17/24 (71%)
C2H2 Zn finger 259..279 CDD:275368 13/19 (68%)
klf15NP_997911.2 zf-C2H2_8 349..428 CDD:292531 55/78 (71%)
C2H2 Zn finger 349..371 CDD:275368 14/21 (67%)
C2H2 Zn finger 379..401 CDD:275368 16/21 (76%)
zf-H2C2_2 393..418 CDD:290200 17/24 (71%)
C2H2 Zn finger 409..429 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BHHA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26322
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 1 1.000 - - X4659
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.