DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and cbt

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster


Alignment Length:305 Identity:93/305 - (30%)
Similarity:134/305 - (43%) Gaps:80/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QQLYSDLEEEPLAGGDALLNIVSVGEFDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNNNTNT 74
            |:|..|.:.|.::   .::.:.|.|...|:..|.:.|..                |...::::||
  Fly    90 QKLDDDQKAERVS---VIMRVNSSGAVSSSSQDENSSSS----------------TSCCSSSSNT 135

  Fly    75 NGNIQVGLPHVEDPSLFIDFNDLTVCPPDLSDWE------QRLLDNYVEIPDLVDFLPERTP--- 130
            |.:.....|.|||     |:       |:.:.|.      .|.....|.:|      |.:||   
  Fly   136 NTSTSSVPPTVED-----DY-------PEANVWRNLKFKMNRKRAAEVALP------PVQTPETP 182

  Fly   131 ---LCTDNC-ADFLEESNSNLRLSGPPHSEIFV-PDRSSSSP-------GSSDSASPAEAVAPPS 183
               |.|... |:.::|....     |..:.|:| |..||:|.       .:..|.:|.     |.
  Fly   183 VAKLVTPPAPAECIKEEEIK-----PILTPIYVSPVASSASQLILLSTVAAQQSPTPV-----PK 237

  Fly   184 ALQMSEN------------AAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVW 236
            ...|||.            |...|.|.|:|.:|.|.|.|.:|||||.|.|.||:|::|.|.:|..
  Fly   238 TPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDK 302

  Fly   237 RFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHER 281
            ||||||||:||||:|:|.|.::|..|.|.|.|||||:||.|.|.:
  Fly   303 RFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 45/78 (58%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 15/21 (71%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 12/19 (63%)
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 13/23 (57%)
C2H2 Zn finger 265..287 CDD:275368 12/21 (57%)
COG5048 <270..362 CDD:227381 45/78 (58%)
zf-H2C2_2 279..306 CDD:290200 15/26 (58%)
C2H2 Zn finger 295..317 CDD:275368 15/21 (71%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 12/21 (57%)
C2H2 Zn finger 325..345 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.