DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf14

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001128566.1 Gene:Klf14 / 312203 RGDID:1306012 Length:321 Species:Rattus norvegicus


Alignment Length:148 Identity:62/148 - (41%)
Similarity:80/148 - (54%) Gaps:8/148 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 DNCADFLEESNSNLRLSGPPH--SEIFVPDRSSSSPGSSDSASPAEAVAPPSALQMSENAAGERG 196
            |..:| .|.|.|...:.|.|.  .|   ||.|...|.....|.|..||.|  ..:..:.....:.
  Rat   136 DELSD-AESSCSESAILGAPEVPEE---PDDSGEVPEGPPGARPGPAVGP--TYRRRQITPASKR 194

  Fly   197 YLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDY 261
            :.|:|..|.|.|.|.:|||:|.|.|.||:|:.|.|.||..:|:||||||||.|:|:|.|.:.|..
  Rat   195 HQCSFHGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPL 259

  Fly   262 CSKCFARSDHLTKHRKVH 279
            |.|.|:||||||||.:.|
  Rat   260 CPKQFSRSDHLTKHARRH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 9/17 (53%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 12/19 (63%)
Klf14NP_001128566.1 COG5048 198..>283 CDD:227381 44/80 (55%)
C2H2 Zn finger 200..219 CDD:275368 9/18 (50%)
zf-H2C2_2 211..238 CDD:290200 14/26 (54%)
C2H2 Zn finger 227..249 CDD:275368 14/21 (67%)
zf-H2C2_2 241..266 CDD:290200 13/24 (54%)
C2H2 Zn finger 257..277 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.