| Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001012051.1 | Gene: | Zfp367 / 306695 | RGDID: | 1307136 | Length: | 340 | Species: | Rattus norvegicus |
| Alignment Length: | 203 | Identity: | 50/203 - (24%) |
|---|---|---|---|
| Similarity: | 75/203 - (36%) | Gaps: | 78/203 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 152 PPHSEIFVPDRS----SSSPGSSD---------------SASPAEA------------------V 179
Fly 180 APPSALQMSENAAGE---------RGYL-----------------------------CTFGNCEK 206
Fly 207 IYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDH 271
Fly 272 LTKHRKVH 279 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 29/78 (37%) |
| C2H2 Zn finger | 203..221 | CDD:275368 | 5/17 (29%) | ||
| C2H2 Zn finger | 229..251 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 243..268 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 259..279 | CDD:275368 | 5/19 (26%) | ||
| Zfp367 | NP_001012051.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 96..140 | 8/43 (19%) | |
| COG5048 | 157..>230 | CDD:227381 | 28/75 (37%) | ||
| zf-C2H2 | 158..179 | CDD:278523 | 6/22 (27%) | ||
| C2H2 Zn finger | 159..179 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 171..198 | CDD:290200 | 14/26 (54%) | ||
| C2H2 Zn finger | 187..209 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 202..228 | CDD:290200 | 10/26 (38%) | ||
| C2H2 Zn finger | 217..256 | CDD:275368 | 6/21 (29%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 280..317 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||