DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf2

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001007685.1 Gene:Klf2 / 306330 RGDID:1359220 Length:351 Species:Rattus norvegicus


Alignment Length:171 Identity:67/171 - (39%)
Similarity:86/171 - (50%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 RLSGP----PHSEIFVPDRSSSSPGSS--------------DSASPAEAVAPP----------SA 184
            ||..|    |....|.|..|...||.:              |.|:.|..:|||          |.
  Rat   181 RLPAPGPRNPFPPPFGPGPSFGGPGPALHYGPPAPGAFGLFDDAAAALGLAPPATRGLLTPPSSP 245

  Fly   185 LQMSENAAGERG-----------YLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRF 238
            |::.| |..:||           :.|::.||.|.|.|.:|||||||.|.|||||.|:|..|.|:|
  Rat   246 LELLE-AKPKRGRRSWPRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKF 309

  Fly   239 SRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            :|||||.||.|.|:|.:|::|..|.:.|:|||||..|.|.|
  Rat   310 ARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRH 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 12/17 (71%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
Klf2NP_001007685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..110
9aaTAD. /evidence=ECO:0000250|UniProtKB:Q9Y5W3 42..50
Interaction with WWP1. /evidence=ECO:0000250 110..264 21/83 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..209 9/27 (33%)
COG5048 <266..346 CDD:227381 43/79 (54%)
zf-C2H2 268..292 CDD:278523 13/23 (57%)
C2H2 Zn finger 270..292 CDD:275368 13/21 (62%)
zf-H2C2_2 284..>306 CDD:290200 15/21 (71%)
C2H2 Zn finger 300..322 CDD:275368 13/21 (62%)
zf-H2C2_2 314..339 CDD:290200 11/24 (46%)
C2H2 Zn finger 330..350 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.