DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf12

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_038949311.1 Gene:Klf12 / 306110 RGDID:1309204 Length:491 Species:Rattus norvegicus


Alignment Length:116 Identity:55/116 - (47%)
Similarity:69/116 - (59%) Gaps:7/116 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 SSSPGSSDSASPAEAVAPPSALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYV 228
            |.||.|.:|.........|.:.:       .|.:.|.|..|.|:|.|.:|||||.|.|.|||||.
  Rat   380 SISPFSIESTRRQRRSESPDSRK-------RRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYK 437

  Fly   229 CSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |:|..|.|:|:|||||.||.|.|:||||:||..|.:.|:|||||..||:.|
  Rat   438 CTWEGCTWKFARSDELTRHYRKHTGVKPFKCADCDRSFSRSDHLALHRRRH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 47/78 (60%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 14/24 (58%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
Klf12XP_038949311.1 KLF12_N 116..313 CDD:410608
COG5048 <314..490 CDD:227381 55/116 (47%)
C2H2 Zn finger 408..430 CDD:275368 12/21 (57%)
C2H2 Zn finger 438..460 CDD:275368 13/21 (62%)
zf-H2C2_2 452..477 CDD:404364 14/24 (58%)
C2H2 Zn finger 468..488 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.