DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and wt1a

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_571121.1 Gene:wt1a / 30245 ZFINID:ZDB-GENE-980526-558 Length:419 Species:Danio rerio


Alignment Length:294 Identity:85/294 - (28%)
Similarity:119/294 - (40%) Gaps:90/294 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 STYVDTSFSGGN--YNQLEFEESDYYG-------------------IITLDSNNNTNTNGNIQVG 81
            |..:|:..|..|  |..:.|:.:..||                   .||..||     .|:.|..
Zfish   120 SNCMDSQSSSRNQGYGTVAFDGASNYGHTPSHHTPQFPNHSFKHEDSITQQSN-----MGDQQYP 179

  Fly    82 LPHVEDPSLFIDFNDLTVC--PPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADFLEESN 144
            :|    |.::       .|  |.|.....|.||              .|.|.   |.:|.|.:..
Zfish   180 VP----PPVY-------GCHTPSDSCTGSQALL--------------LRNPY---NSSDNLYQMA 216

  Fly   145 SNLRLSG--PPHSEIFVPDRSSSSPG--SSDSASP-------------------------AEAVA 180
            |.|...|  |.:|   :.....|.||  .||.::|                         ...:.
Zfish   217 SQLECMGWNPVNS---LASTIKSHPGGYESDPSTPMVYSCSTQYRIHTHGVFRGLQDVRRVPGIT 278

  Fly   181 PPSALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELA 245
            |  |:..|.....:|.::|.:..|.|.|.|.:||:.|.|:|.|||||.|.:.||..||||||:|.
Zfish   279 P--AIVRSTETNEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFTDCGRRFSRSDQLK 341

  Fly   246 RHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            ||:|.|:||||::|:.|.:.|:|||||..|.:.|
Zfish   342 RHQRRHTGVKPFQCETCQRKFSRSDHLKTHTRTH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 42/78 (54%)
C2H2 Zn finger 203..221 CDD:275368 8/17 (47%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 12/24 (50%)
C2H2 Zn finger 259..279 CDD:275368 9/19 (47%)
wt1aNP_571121.1 WT1 1..291 CDD:280348 41/208 (20%)
COG5048 286..>411 CDD:227381 44/90 (49%)
C2H2 Zn finger 298..317 CDD:275368 8/18 (44%)
zf-H2C2_2 309..336 CDD:290200 15/26 (58%)
C2H2 Zn finger 325..347 CDD:275368 13/21 (62%)
zf-H2C2_2 340..364 CDD:290200 12/23 (52%)
C2H2 Zn finger 355..375 CDD:275368 9/19 (47%)
C2H2 Zn finger 386..408 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.