DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf1

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_571011.1 Gene:klf1 / 30104 ZFINID:ZDB-GENE-980526-55 Length:365 Species:Danio rerio


Alignment Length:269 Identity:82/269 - (30%)
Similarity:119/269 - (44%) Gaps:65/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EFDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNNNTNTN----------GNIQVGLPHVEDP- 88
            :|:..::|.. :..:|:|.  |....:....:.||.|.:::          |:.....|.:..| 
Zfish   137 QFNCGFLDQQ-AAKSYSQA--ENPQQFSAFPVTSNVNRDSSMGKMGKSWDFGHYYQPAPLISFPD 198

  Fly    89 SLFIDFNDLT----VCPPDLSDWEQRLLDNYVEIPDLVDFLPERT-PLCTDNCADFLEESNSNLR 148
            |.|:....:|    |.||.         .:|       :|:|..: |......|:::...     
Zfish   199 SKFVQTQGITMETVVFPPH---------HHY-------NFIPSYSHPRLYQQQANYVHRP----- 242

  Fly   149 LSGPPHSEIFVPDRSSSSPGSSDSASPAEAVAPPSALQMSENAAGERG--------YLCTFGNCE 205
               ||.|..  |...|..|.|:         .||:.|   |:....||        :.|.:..|:
Zfish   243 ---PPQSHF--PSTQSMVPDST---------VPPAGL---ESKRIRRGLVKRKATVHSCEYPGCQ 290

  Fly   206 KIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSD 270
            |.|.|.:|||||||.|.|||||.|:|..|.|:|:|||||.||.|.|:|.|||:|..|.:.|:|||
Zfish   291 KTYTKSSHLKAHLRTHTGEKPYHCTWDGCGWKFARSDELTRHFRKHTGQKPYECLLCHRAFSRSD 355

  Fly   271 HLTKHRKVH 279
            ||..|.|.|
Zfish   356 HLALHMKRH 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 45/78 (58%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
klf1NP_571011.1 COG5048 287..>344 CDD:227381 35/56 (63%)
C2H2 Zn finger 287..306 CDD:275368 11/18 (61%)
zf-H2C2_2 298..>315 CDD:290200 13/16 (81%)
C2H2 Zn finger 314..336 CDD:275368 13/21 (62%)
zf-H2C2_2 328..353 CDD:290200 13/24 (54%)
C2H2 Zn finger 344..364 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.