DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf17

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_038967113.1 Gene:Klf17 / 298449 RGDID:1307711 Length:383 Species:Rattus norvegicus


Alignment Length:294 Identity:82/294 - (27%)
Similarity:135/294 - (45%) Gaps:55/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIVSVGEFDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNNNTN-----------TNGNIQ--- 79
            :::.||...:..|..|||....:|.........|:..:..:|...           |.|:::   
  Rat   102 HVMPVGNPGTLGVAISFSENLMSQGGLSSPASCGVSVMTHSNAPTMPYSVSPTVPATTGSLKPGI 166

  Fly    80 ---VGLPHVEDPSLFIDFNDL--TVCPPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADF 139
               .|:|..|..::....|.:  :|.|..:|...|:||.           :..:..|.|      
  Rat   167 FLVPGMPSAETHAVTPYMNQMLHSVNPEMVSARFQQLLP-----------IDSQDSLAT------ 214

  Fly   140 LEESNSNLRLSGPPHSEIFVPDRSSSSPGSSDSASPAEAVAPPSALQMSENAAGERGYLCTFGNC 204
                .||:: .||     |:.::.:.:|...::||.:.......:|.:       |.|:|::.:|
  Rat   215 ----QSNVQ-EGP-----FMCEQPTPAPQERETASTSRGATRRRSLVL-------RPYVCSYDDC 262

  Fly   205 EKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARS 269
            .|.|.|.:||.:|||:|.|||||:|.|..|.|||.|||||.||||.|:..:|:|||.|::.|.||
  Rat   263 GKAYTKRSHLVSHLRKHTGEKPYICDWKGCKWRFFRSDELGRHKRIHTRYRPHKCDECNREFMRS 327

  Fly   270 DHLTKHRKVHERRLLAASRAGRSLISDDLYAVRP 303
            |||.:|::.|..:.:....:.|.  ..:.|.:.|
  Rat   328 DHLRQHKRTHLPKTVGLHTSTRK--PGETYTLNP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 9/17 (53%)
C2H2 Zn finger 229..251 CDD:275368 15/21 (71%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
Klf17XP_038967113.1 KLF17_N 1..259 CDD:410567 35/190 (18%)
zf-C2H2 255..279 CDD:395048 11/23 (48%)
C2H2 Zn finger 260..279 CDD:275368 9/18 (50%)
C2H2 Zn finger 287..309 CDD:275368 15/21 (71%)
zf-H2C2_2 304..324 CDD:404364 10/19 (53%)
zf-C2H2 315..337 CDD:395048 11/21 (52%)
C2H2 Zn finger 317..337 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.