DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and hsr1

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_593553.1 Gene:hsr1 / 2543251 PomBaseID:SPAC3H1.11 Length:582 Species:Schizosaccharomyces pombe


Alignment Length:297 Identity:72/297 - (24%)
Similarity:122/297 - (41%) Gaps:87/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DSTYVDTSF--------SGGNYNQLEFEESDYYGIITLDSNN------NTNTNGNIQVGLPH--V 85
            |:|.:.:||        :..|..::.::.|..|...|...||      |.|.. |....:|:  .
pombe   210 DATDIPSSFNFYNTQASTAPNPQEINYQWSHEYRPHTQYQNNLLRAQPNVNCE-NFPTTVPNYPF 273

  Fly    86 EDPSLFIDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLP-------ERTPLCT-----DNCAD 138
            :.||    :|...:.|            :|.   .||..||       ...||.|     .||  
pombe   274 QQPS----YNPNALVP------------SYT---TLVSQLPPSPCLTVSSGPLSTASSIPSNC-- 317

  Fly   139 FLEESNSNLRLSGPPH---SEIFVPDRSSSSPGSSDSASPAEAVA-------------------- 180
                |..:::.|||.:   .|:.|...:...|.:|.:.:|.::|.                    
pombe   318 ----SCPSVKSSGPSYHAEQEVNVNSYNGGIPSTSYNDTPQQSVTGSYNSGETMSTYLNQTNTSG 378

  Fly   181 -PPSALQMSENAAGERGYLCTFGNCEKIYAK-PAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDE 243
             .|::::.:|    :.|.:.|.|:.::...: |::.|..:.|..|.|.:||  |:|..:|.||:.
pombe   379 RSPNSMEATE----QIGTIGTDGSMKRRKRRQPSNRKTSVPRSPGGKSFVC--PECSKKFKRSEH 437

  Fly   244 LARHKRS-HSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |.||.|| |:..||:.| .|.|.|:|.|:|.:|.::|
pombe   438 LRRHIRSLHTSEKPFVC-ICGKRFSRRDNLRQHERLH 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 30/80 (38%)
C2H2 Zn finger 203..221 CDD:275368 2/18 (11%)
C2H2 Zn finger 229..251 CDD:275368 11/22 (50%)
zf-H2C2_2 243..268 CDD:290200 12/25 (48%)
C2H2 Zn finger 259..279 CDD:275368 8/19 (42%)
hsr1NP_593553.1 COG5048 103..582 CDD:227381 72/297 (24%)
zf-C2H2 423..444 CDD:278523 10/22 (45%)
C2H2 Zn finger 425..446 CDD:275368 11/22 (50%)
zf-H2C2_2 437..462 CDD:290200 12/25 (48%)
C2H2 Zn finger 454..473 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.990

Return to query results.
Submit another query.