DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and prz1

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:322 Identity:82/322 - (25%)
Similarity:124/322 - (38%) Gaps:76/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLAGGDALLNIVSVGEFDSTYVDTSFSG-GNYNQLEFEESDYYGIITLDSNNNTNTNGNIQV--- 80
            |.|..:::||          |...:||| ...|.:....|......:|.:|....|:.:|..   
pombe   391 PTALSNSVLN----------YDSNNFSGTPQINVVPSSPSKSQSGPSLPANPLLQTDISITYSQS 445

  Fly    81 -----GLPHVEDPSLFIDFNDLTVCPPDLS-DWEQR--------LLDNYVEIPDL-VDFLPERTP 130
                 |.|.:.:.|  .|..:..:|.|::| .:..|        ..|.|..||.| ..|......
pombe   446 ASPVSGQPAMNENS--YDLQNANLCAPEMSPTYTARHRSNSAGSRFDAYEPIPQLYTHFSHSSEC 508

  Fly   131 LCTDNCADFL-----EESNSNLRLS---GPPHSEIF------VPDRSSSSPGSSDSASPAEAVAP 181
            |..:...:.|     :.|.||..||   ..|.|...      ..:.||||...|:|.|       
pombe   509 LSVNQDTELLGKIENDNSKSNDYLSVRNTRPRSRSLNSLVGNKSENSSSSKAKSESKS------- 566

  Fly   182 PSALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELAR 246
                        :..|:|||..|.|.:.:..:||:|:..|...:|:.||  .|...|:|..:..|
pombe   567 ------------QGNYVCTFAGCNKRFTRAYNLKSHMNTHTNYRPFQCS--ICKKSFARQHDKRR 617

  Fly   247 HKRSHSGVKPYKCDYCSKCFARSDHLTKHRK--VHERRLLAASRAGRSLISDDLYAVRPGRK 306
            |::.|:|:|.:.|..|::.|||.|.|.:|.|  |.:..|..|:..|        ..|.|.||
pombe   618 HEQLHTGIKAFACVTCNQRFARMDALNRHYKSEVGQNCLRTATERG--------IQVPPSRK 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 29/80 (36%)
C2H2 Zn finger 203..221 CDD:275368 5/17 (29%)
C2H2 Zn finger 229..251 CDD:275368 7/21 (33%)
zf-H2C2_2 243..268 CDD:290200 8/24 (33%)
C2H2 Zn finger 259..279 CDD:275368 9/21 (43%)
prz1NP_593073.1 COG5048 121..620 CDD:227381 62/261 (24%)
zf-C2H2 570..594 CDD:278523 9/23 (39%)
C2H2 Zn finger 577..594 CDD:275368 5/16 (31%)
zf-H2C2_2 586..611 CDD:290200 9/26 (35%)
C2H2 Zn finger 602..622 CDD:275368 7/21 (33%)
zf-H2C2_2 616..639 CDD:290200 8/22 (36%)
C2H2 Zn finger 630..648 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.990

Return to query results.
Submit another query.