DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and Zfp7

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	NP_001345745.1	Gene:	Zfp7 / 223669	MGIID:	99208	Length:	685	Species:	Mus musculus

Alignment Length:	87	Identity:	39/87 - (44%)
Similarity:	50/87 - (57%)	Gaps:	4/87 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            ||:.:.|  ..|.|.:.:.:||..|.|.|.|||||||.  ||...|::|..|..|:|.|.|.|||
Mouse   464 GEKPFKC--DECGKRFVQSSHLIQHQRIHTGEKPYVCD--DCGRAFTQSSSLIYHQRIHKGEKPY 524

  Fly   258 KCDYCSKCFARSDHLTKHRKVH 279
            ||..|.|.|:.|..||.|::.|
Mouse   525 KCSQCGKAFSMSTQLTSHQRTH 546

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	36/78 (46%)
		C2H2 Zn finger	203..221	CDD:275368	6/17 (35%)
		C2H2 Zn finger	229..251	CDD:275368	8/21 (38%)
		zf-H2C2_2	243..268	CDD:290200	13/24 (54%)
		C2H2 Zn finger	259..279	CDD:275368	8/19 (42%)
Zfp7	NP_001345745.1	KRAB	4..65	CDD:214630
		C2H2 Zn finger	194..214	CDD:275368
		C2H2 Zn finger	222..242	CDD:275368
		COG5048	246..668	CDD:227381	39/87 (45%)
		C2H2 Zn finger	250..270	CDD:275368
		C2H2 Zn finger	278..298	CDD:275368
		C2H2 Zn finger	306..326	CDD:275368
		C2H2 Zn finger	334..354	CDD:275368
		C2H2 Zn finger	362..380	CDD:275368
		C2H2 Zn finger	414..434	CDD:275368
		C2H2 Zn finger	442..462	CDD:275368
		C2H2 Zn finger	470..490	CDD:275368	7/21 (33%)
		C2H2 Zn finger	498..518	CDD:275368	8/21 (38%)
		C2H2 Zn finger	526..546	CDD:275368	8/19 (42%)
		C2H2 Zn finger	554..574	CDD:275368
		C2H2 Zn finger	582..602	CDD:275368
		C2H2 Zn finger	635..655	CDD:275368
		C2H2 Zn finger	663..683	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000