Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005273482.1 | Gene: | EGR3 / 1960 | HGNCID: | 3240 | Length: | 442 | Species: | Homo sapiens |
Alignment Length: | 324 | Identity: | 77/324 - (23%) |
---|---|---|---|
Similarity: | 124/324 - (38%) | Gaps: | 94/324 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 NIVSVG-EFDSTYVDTSFSG------GNYNQLEFEESDYYGIITLDSNNN--------------- 71
Fly 72 ------------TNT-------NGNIQVGLPHVEDPS----LF---IDFND------LTVCPPDL 104
Fly 105 SDWEQRLLDN-YVEIPDL--------VDFLPERTPLCTDNCADFLEESNSNLRLSGPPHSEI--- 157
Fly 158 -FVPDRSSSSPGSSDSASPAEAVAP------PSALQMSENAAGERGYLCTFGNCEKIYAKPAHLK 215
Fly 216 AHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 32/78 (41%) |
C2H2 Zn finger | 203..221 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 229..251 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 243..268 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 259..279 | CDD:275368 | 9/19 (47%) | ||
EGR3 | XP_005273482.1 | DUF3446 | 142..202 | CDD:288757 | 8/59 (14%) |
COG5048 | 324..>388 | CDD:227381 | 25/65 (38%) | ||
zf-C2H2 | 330..354 | CDD:278523 | 6/23 (26%) | ||
C2H2 Zn finger | 332..354 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 346..371 | CDD:290200 | 11/26 (42%) | ||
COG5048 | 358..>431 | CDD:227381 | 26/55 (47%) | ||
C2H2 Zn finger | 362..382 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 374..399 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 9/19 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |