DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and odd-2

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_509032.1 Gene:odd-2 / 183219 WormBaseID:WBGene00003846 Length:254 Species:Caenorhabditis elegans


Alignment Length:191 Identity:52/191 - (27%)
Similarity:78/191 - (40%) Gaps:50/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LVDFLPER----------TPLCTD---------NCADFLEESNSNLRLSGPPHSEIFVPDRSSSS 166
            |.:||.:|          .|:.||         :.||.: ||...::             ..|.|
 Worm    32 LQNFLQQRKMALLAMNPEIPMITDLKKAKFDFTHMADSI-ESEQKIK-------------EESVS 82

  Fly   167 PGSSDSASPAEAVAP-----------PSALQMSENAA-GERGYLCTFGNCEKIYAKPAHLKAHLR 219
            |..|.:.:.| ||.|           |...:.:..|| .::.::|.:  |::.:.|..:|..|.|
 Worm    83 PKMSPTLTTA-AVRPFVPYDQPWFMIPGRGRTTGRAARPKKEFICKY--CDRHFTKSYNLLIHER 144

  Fly   220 RHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHE 280
            .|..|:||.|.  .|...|.|.|.|..||..|...:|:||:.|.|.|.:|..|..||..|:
 Worm   145 THTDERPYSCD--VCGKAFRRQDHLRDHKYIHQKDRPFKCEICGKGFCQSRTLLVHRATHD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 29/78 (37%)
C2H2 Zn finger 203..221 CDD:275368 5/17 (29%)
C2H2 Zn finger 229..251 CDD:275368 8/21 (38%)
zf-H2C2_2 243..268 CDD:290200 10/24 (42%)
C2H2 Zn finger 259..279 CDD:275368 8/19 (42%)
odd-2NP_509032.1 zf-C2H2 124..146 CDD:278523 6/23 (26%)
C2H2 Zn finger 126..146 CDD:275368 6/21 (29%)
zf-H2C2_2 138..163 CDD:290200 10/26 (38%)
C2H2 Zn finger 154..174 CDD:275368 8/21 (38%)
zf-H2C2_2 166..189 CDD:290200 9/22 (41%)
zf-C2H2 180..202 CDD:278523 9/21 (43%)
C2H2 Zn finger 182..202 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.