DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and ZNF100

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	NP_775802.2	Gene:	ZNF100 / 163227	HGNCID:	12880	Length:	542	Species:	Homo sapiens

Alignment Length:	87	Identity:	43/87 - (49%)
Similarity:	51/87 - (58%)	Gaps:	4/87 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            ||:.|.|.  .|.|.:.:.:||..|...|.|||||.|.  :|...|:||..|..|||.|:|||||
Human   257 GEKPYKCE--ECGKAFNRSSHLTTHKIIHTGEKPYRCE--ECGKAFNRSSHLTTHKRIHTGVKPY 317

  Fly   258 KCDYCSKCFARSDHLTKHRKVH 279
            ||..|.|.|.||.|||.||.:|
Human   318 KCTECGKAFNRSSHLTTHRIIH 339

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	39/78 (50%)
		C2H2 Zn finger	203..221	CDD:275368	5/17 (29%)
		C2H2 Zn finger	229..251	CDD:275368	9/21 (43%)
		zf-H2C2_2	243..268	CDD:290200	15/24 (63%)
		C2H2 Zn finger	259..279	CDD:275368	11/19 (58%)
ZNF100	NP_775802.2	KRAB	35..96	CDD:214630
		KRAB	35..74	CDD:279668
		COG5048	150..534	CDD:227381	43/87 (49%)
		C2H2 Zn finger	207..227	CDD:275368
		C2H2 Zn finger	235..255	CDD:275368
		zf-H2C2_2	248..272	CDD:290200	6/16 (38%)
		C2H2 Zn finger	263..283	CDD:275368	6/21 (29%)
		zf-H2C2_2	275..300	CDD:290200	12/26 (46%)
		C2H2 Zn finger	291..311	CDD:275368	9/21 (43%)
		zf-H2C2_2	303..328	CDD:290200	15/24 (63%)
		C2H2 Zn finger	319..339	CDD:275368	11/19 (58%)
		zf-H2C2_2	331..356	CDD:290200	6/9 (67%)
		C2H2 Zn finger	347..367	CDD:275368
		C2H2 Zn finger	375..395	CDD:275368
		C2H2 Zn finger	403..423	CDD:275368
		zf-H2C2_2	415..439	CDD:290200
		C2H2 Zn finger	431..451	CDD:275368
		zf-H2C2_2	443..468	CDD:290200
		C2H2 Zn finger	459..479	CDD:275368
		zf-H2C2_2	472..496	CDD:290200
		C2H2 Zn finger	487..507	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000