DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and KLF14

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_619638.2 Gene:KLF14 / 136259 HGNCID:23025 Length:323 Species:Homo sapiens


Alignment Length:217 Identity:70/217 - (32%)
Similarity:98/217 - (45%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PHVEDPSLFIDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDN-CADFLEESNSN 146
            ||:...|::.|....:    ....||     |..|.|.......:..|..... |::....|.: 
Human    81 PHLLAASVWADLRGSS----GEGSWE-----NSGEAPRASSGFSDPIPCSVQTPCSELAPASGA- 135

  Fly   147 LRLSGPPHSEIFVPDRSSSSP-------------------GSSDSASPAEAVAPPSALQMSENAA 192
                    :.:..|:.||.:|                   |.:..|.||.| |..:..:.|...|
Human   136 --------AAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPA-ADQAPRRRSVTPA 191

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            .:| :.|.|..|.|.|.|.:|||:|.|.|.||:|:.|.|.||..:|:||||||||.|:|:|.|.:
Human   192 AKR-HQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRF 255

  Fly   258 KCDYCSKCFARSDHLTKHRKVH 279
            .|..|.|.|:||||||||.:.|
Human   256 SCPLCPKQFSRSDHLTKHARRH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 9/17 (53%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 12/19 (63%)
KLF14NP_619638.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..80
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 5/30 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..161 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..195 9/30 (30%)
COG5048 198..>283 CDD:227381 44/80 (55%)
C2H2 Zn finger 200..219 CDD:275368 9/18 (50%)
C2H2 Zn finger 227..249 CDD:275368 14/21 (67%)
C2H2 Zn finger 257..277 CDD:275368 12/19 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.