DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and OSR1

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_660303.1 Gene:OSR1 / 130497 HGNCID:8111 Length:266 Species:Homo sapiens


Alignment Length:259 Identity:63/259 - (24%)
Similarity:100/259 - (38%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NYNQLEFEESDYYGIITLDSNNNTNTNGNIQVGLPHVED-----PSLFIDFNDLTVCPPDLSDWE 108
            ||:.|:...    |:.|:.|::..|..|...:...|:..     |::.:..:..:..|..:|.  
Human    20 NYSFLQAVN----GLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSS-- 78

  Fly   109 QRLLDNYVEI------PDLVDFLPERT------PLCTDNCADFLEESNSNLRLSGPPHSEIFVPD 161
              |:|...::      |.::...||.|      .|.|....||     :||.|:.....    |.
Human    79 --LVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDF-----ANLALAATQED----PA 132

  Fly   162 RSSSSPGSSDSASPAEAVAPPSALQMSENAAGERG---------YLCTFGNCEKIYAKPAHLKAH 217
            :.....|....|....|:.  ...::|......||         ::|.|  |.:.:.|..:|..|
Human   133 KLGRGEGPGSPAGGLGALL--DVTKLSPEKKPTRGRLPSKTKKEFVCKF--CGRHFTKSYNLLIH 193

  Fly   218 LRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHER 281
            .|.|..|:||.|.  .|...|.|.|.|..|:..||..||:||..|.|.|.:|..|..|:.:|.:
Human   194 ERTHTDERPYTCD--ICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 30/78 (38%)
C2H2 Zn finger 203..221 CDD:275368 5/17 (29%)
C2H2 Zn finger 229..251 CDD:275368 7/21 (33%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
OSR1NP_660303.1 zf-C2H2 175..197 CDD:306579 7/23 (30%)
C2H2 Zn finger 177..197 CDD:275368 7/21 (33%)
zf-H2C2_2 189..214 CDD:316026 10/26 (38%)
C2H2 Zn finger 205..225 CDD:275368 7/21 (33%)
zf-H2C2_2 217..240 CDD:316026 10/22 (45%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.