DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf2b

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_571932.1 Gene:klf2b / 117509 ZFINID:ZDB-GENE-011109-2 Length:363 Species:Danio rerio


Alignment Length:326 Identity:92/326 - (28%)
Similarity:131/326 - (40%) Gaps:83/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YSDLEEEPLAGGDALLNIVSVGEFDSTYVDTSFSGGNYNQLEF---EESDYYGIIT------LDS 68
            |.|||       ..|.|.....|..:.::..|...|.|:...:   |....||::.      :||
Zfish    61 YLDLE-------FILANTTGPLEAGAEFISHSEPCGMYSTAVYSSPEAPPPYGLMAELLRSDVDS 118

  Fly    69 NNNTNTNGNIQV---GLPHVEDPSLFIDFNDLTVCPPDLSDWEQRLLDNYVEIPDLV-------- 122
            ..:|...|...:   |.|..|.|.:.::       ||         :|.|..:..:|        
Zfish   119 TYDTTVQGRFLLNSSGFPRQEFPEIKVE-------PP---------MDGYGPVIGMVPQTCQKIK 167

  Fly   123 ---------DFLPER---TPLCTDNCADFLEESNSNLRL---------SGPPHSEI---FVPDRS 163
                     .|...|   :|..|.|....|...:|:||.         |.|.:.::   |.....
Zfish   168 QEGNVSCMMSFEQPRLAVSPQATGNMTPPLSPDDSHLRQTTYTQSYHHSPPAYPQVPMQFTAPHQ 232

  Fly   164 ----SSSPGSSDSASPAEAVAPPSALQMSENAAGERG-----------YLCTFGNCEKIYAKPAH 213
                ..:.|...|...|....|.|.|::.|:.. :||           :.||:..|.|.|.|.:|
Zfish   233 FAMYEEAMGMQPSMQRALLTPPSSPLELMESKP-KRGRRTWPRKRMATHTCTYAGCGKTYTKSSH 296

  Fly   214 LKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKV 278
            ||||.|.|.|||||.|:|..|.|:|:|||||.||.|.|:|.:|::|..|.:.|:|||||..|.|.
Zfish   297 LKAHHRTHTGEKPYHCNWEGCGWKFARSDELTRHFRKHTGHRPFQCHLCERAFSRSDHLALHMKR 361

  Fly   279 H 279
            |
Zfish   362 H 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 43/78 (55%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
klf2bNP_571932.1 COG5048 <197..>362 CDD:227381 60/165 (36%)
zf-C2H2 280..304 CDD:278523 12/23 (52%)
C2H2 Zn finger 282..304 CDD:275368 12/21 (57%)
C2H2 Zn finger 312..334 CDD:275368 13/21 (62%)
zf-H2C2_2 326..351 CDD:290200 11/24 (46%)
C2H2 Zn finger 342..362 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.