DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf2a

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_571931.2 Gene:klf2a / 117508 ZFINID:ZDB-GENE-011109-1 Length:380 Species:Danio rerio


Alignment Length:217 Identity:71/217 - (32%)
Similarity:90/217 - (41%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ITLDSNNNTNTNGNIQVGLPHVEDPSLFIDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLPER 128
            :|...:...||      |.||              ..||.:.                   ||.:
Zfish   221 LTFSQSYQGNT------GFPH--------------AAPPQMQ-------------------LPYQ 246

  Fly   129 TPLCTDNCADFLEESNSNLR-LSGPPHSEIFVPDRSSSSPGSSDSASPAEAVAPPSALQMSENAA 192
            :......|.|.|...|:|.| |..||                   :||.|..|.|...:.:....
Zfish   247 STHHFSMCDDGLAMPNANQRVLLTPP-------------------SSPLELDAKPKRGRRTWPRK 292

  Fly   193 GERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPY 257
            ....:.|||..|.|.|.|.:|||||.|.|.|||||.|||..|.|:|:|||||.||.|.|:|.:|:
Zfish   293 RTATHTCTFSGCGKTYTKSSHLKAHHRTHTGEKPYHCSWEGCGWKFARSDELTRHFRKHTGHRPF 357

  Fly   258 KCDYCSKCFARSDHLTKHRKVH 279
            :|..|.:.|:|||||..|.|.|
Zfish   358 QCHLCERAFSRSDHLALHMKRH 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 45/78 (58%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 10/19 (53%)
klf2aNP_571931.2 COG5048 <273..>364 CDD:227381 43/90 (48%)
C2H2 Zn finger 302..321 CDD:275368 10/18 (56%)
C2H2 Zn finger 329..351 CDD:275368 14/21 (67%)
zf-H2C2_2 343..368 CDD:290200 11/24 (46%)
C2H2 Zn finger 359..379 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.