DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Klf3

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001099212.1 Gene:Klf3 / 114845 RGDID:1593290 Length:344 Species:Rattus norvegicus


Alignment Length:206 Identity:68/206 - (33%)
Similarity:105/206 - (50%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 HVEDPSLF-----IDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADFLEES 143
            |::.|.:.     :|.::..:..|.:..:|:.:|...::|...::  |:||        |:..| 
  Rat   159 HLQQPLMVSLSEEMDNSNSGMPVPVIESYEKPILQKKIKIEPGIE--PQRT--------DYYPE- 212

  Fly   144 NSNLRLSGPPHSEIFVPDRSSSSPGSS--DSASPAEAVAP---PSALQMSENAAGERGYLCTFGN 203
                        |:..|..:|.||..:  ....|:..|.|   |..::..:.....|.:.|.:..
  Rat   213 ------------EMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDG 265

  Fly   204 CEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFAR 268
            |.|:|.|.:|||||.|.|.|||||.|:|..|.|:|:|||||.||.|.|:|:||::|..|.:.|:|
  Rat   266 CNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSR 330

  Fly   269 SDHLTKHRKVH 279
            ||||..|||.|
  Rat   331 SDHLALHRKRH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 12/24 (50%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)
Klf3NP_001099212.1 COG5048 <169..>331 CDD:227381 57/184 (31%)
zf-C2H2 259..283 CDD:278523 11/23 (48%)
C2H2 Zn finger 261..283 CDD:275368 11/21 (52%)
zf-H2C2_2 275..>292 CDD:290200 12/16 (75%)
C2H2 Zn finger 291..313 CDD:275368 13/21 (62%)
zf-H2C2_2 305..330 CDD:290200 12/24 (50%)
C2H2 Zn finger 321..341 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.