Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099212.1 | Gene: | Klf3 / 114845 | RGDID: | 1593290 | Length: | 344 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 68/206 - (33%) |
---|---|---|---|
Similarity: | 105/206 - (50%) | Gaps: | 33/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 HVEDPSLF-----IDFNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADFLEES 143
Fly 144 NSNLRLSGPPHSEIFVPDRSSSSPGSS--DSASPAEAVAP---PSALQMSENAAGERGYLCTFGN 203
Fly 204 CEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFAR 268
Fly 269 SDHLTKHRKVH 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 44/78 (56%) |
C2H2 Zn finger | 203..221 | CDD:275368 | 10/17 (59%) | ||
C2H2 Zn finger | 229..251 | CDD:275368 | 13/21 (62%) | ||
zf-H2C2_2 | 243..268 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 259..279 | CDD:275368 | 11/19 (58%) | ||
Klf3 | NP_001099212.1 | COG5048 | <169..>331 | CDD:227381 | 57/184 (31%) |
zf-C2H2 | 259..283 | CDD:278523 | 11/23 (48%) | ||
C2H2 Zn finger | 261..283 | CDD:275368 | 11/21 (52%) | ||
zf-H2C2_2 | 275..>292 | CDD:290200 | 12/16 (75%) | ||
C2H2 Zn finger | 291..313 | CDD:275368 | 13/21 (62%) | ||
zf-H2C2_2 | 305..330 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 321..341 | CDD:275368 | 11/19 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |