| Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011533209.1 | Gene: | KLF12 / 11278 | HGNCID: | 6346 | Length: | 415 | Species: | Homo sapiens |
| Alignment Length: | 370 | Identity: | 97/370 - (26%) |
|---|---|---|---|
| Similarity: | 136/370 - (36%) | Gaps: | 121/370 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 YSDLEEEPLAGGDALLNIVSVGE--FDSTYVD--------------------------------- 42
Fly 43 ------TSFSGGNYNQLEFEESDYYGIITLDSNNNTNTNGNIQVGLP--------HVEDPSLFID 93
Fly 94 FNDLTVCPPDLSDWEQRLLDNYVEIPDLVDFLP-----ERTPLCTDN--CADFLEESNSNLRLSG 151
Fly 152 PPHSEIFVPDRSSSSPGSSD---------------SASPAEAV-----APPSALQ---------- 186
Fly 187 -----------------MSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDC 234
Fly 235 VWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 47/78 (60%) |
| C2H2 Zn finger | 203..221 | CDD:275368 | 10/17 (59%) | ||
| C2H2 Zn finger | 229..251 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 243..268 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 259..279 | CDD:275368 | 10/19 (53%) | ||
| KLF12 | XP_011533209.1 | COG5048 | <241..414 | CDD:227381 | 61/174 (35%) |
| zf-C2H2 | 330..354 | CDD:278523 | 12/23 (52%) | ||
| C2H2 Zn finger | 332..354 | CDD:275368 | 12/21 (57%) | ||
| zf-H2C2_2 | 346..>363 | CDD:290200 | 12/16 (75%) | ||
| C2H2 Zn finger | 362..384 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 376..401 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 392..412 | CDD:275368 | 10/19 (53%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||