DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and Osr2

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001355594.1 Gene:Osr2 / 107587 MGIID:1930813 Length:312 Species:Mus musculus


Alignment Length:138 Identity:43/138 - (31%)
Similarity:61/138 - (44%) Gaps:9/138 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SNLRLSGPPHSEIFVPDRSSSSPGSSDSASPAEAVAP---PSALQMSENAAGERGYLCTFGNCEK 206
            :||.::........:.|.|..|||.....|....:.|   ||..::......|  ::|.|  |.:
Mouse   119 ANLAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLNPDRKPSRGRLPSKTKKE--FICKF--CGR 179

  Fly   207 IYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDH 271
            .:.|..:|..|.|.|..|:||.|.  .|...|.|.|.|..|:..||..||:||..|.|.|.:|..
Mouse   180 HFTKSYNLLIHERTHTDERPYTCD--ICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRT 242

  Fly   272 LTKHRKVH 279
            |..|:.:|
Mouse   243 LAVHKTLH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 30/78 (38%)
C2H2 Zn finger 203..221 CDD:275368 5/17 (29%)
C2H2 Zn finger 229..251 CDD:275368 7/21 (33%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
Osr2NP_001355594.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..165 4/18 (22%)
C2H2 Zn finger 174..194 CDD:275368 7/21 (33%)
zf-H2C2_2 186..211 CDD:338759 10/26 (38%)
C2H2 Zn finger 202..222 CDD:275368 7/21 (33%)
zf-H2C2_2 214..237 CDD:338759 10/22 (45%)
C2H2 Zn finger 230..250 CDD:275368 7/19 (37%)
COG5048 251..>312 CDD:227381 43/138 (31%)
C2H2 Zn finger 258..278 CDD:275368
C2H2 Zn finger 286..306 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.