| Sequence 1: | NP_572185.1 | Gene: | Klf15 / 31410 | FlyBaseID: | FBgn0025679 | Length: | 311 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_057354.1 | Gene: | KLF2 / 10365 | HGNCID: | 6347 | Length: | 355 | Species: | Homo sapiens |
| Alignment Length: | 195 | Identity: | 70/195 - (35%) |
|---|---|---|---|
| Similarity: | 92/195 - (47%) | Gaps: | 52/195 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 126 PERTPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDRSS---SSPGS---------------SDS 172
Fly 173 ASPAEA--VAPPSA----------LQMSENAAGERG-----------YLCTFGNCEKIYAKPAHL 214
Fly 215 KAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
Fly 280 279 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Klf15 | NP_572185.1 | zf-C2H2_8 | 199..278 | CDD:292531 | 43/78 (55%) |
| C2H2 Zn finger | 203..221 | CDD:275368 | 11/17 (65%) | ||
| C2H2 Zn finger | 229..251 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 243..268 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 259..279 | CDD:275368 | 10/19 (53%) | ||
| KLF2 | NP_057354.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..42 | ||
| 9aaTAD. /evidence=ECO:0000269|PubMed:31375868 | 43..51 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..90 | ||||
| Interaction with WWP1. /evidence=ECO:0000250 | 111..268 | 25/107 (23%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 120..209 | 12/47 (26%) | |||
| COG5048 | <267..350 | CDD:227381 | 42/82 (51%) | ||
| zf-C2H2 | 272..296 | CDD:278523 | 12/23 (52%) | ||
| C2H2 Zn finger | 274..296 | CDD:275368 | 12/21 (57%) | ||
| zf-H2C2_2 | 288..>310 | CDD:290200 | 15/21 (71%) | ||
| C2H2 Zn finger | 304..326 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 318..343 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 334..354 | CDD:275368 | 10/19 (53%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||