DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf15

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_002938279.1 Gene:klf15 / 100495857 XenbaseID:XB-GENE-854149 Length:394 Species:Xenopus tropicalis


Alignment Length:304 Identity:104/304 - (34%)
Similarity:145/304 - (47%) Gaps:62/304 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VSVGEFDSTYVDTSFSGGNYNQLE----------FEESDYYGIITLDSNNNTNTNGNIQVGLPHV 85
            :.|.||.....:|:|.....:::|          |::.|.:....|      .|.|.: ...||.
 Frog   107 LKVPEFGVDMEETTFFHPTLDEIEEFLEENMKTDFKDEDRHDAKEL------RTCGQL-FSDPHA 164

  Fly    86 EDPSLFIDFNDLTV--CPPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADFLEESNSNLR 148
            .:.|:..|.|..|:  .|.|    |.....:.|.:...:..:.:..|:      :..:|||:|..
 Frog   165 VNSSMKEDINGETILSVPED----ENTKGSDAVSVEGGIPVILQIQPI------EIKQESNTNQS 219

  Fly   149 LSGPPHSEI-------------FVPDRSSSSPGSSD--SASP----AEAVAPPSALQ-------- 186
            ...|.:.::             .||....||..||.  ..:|    |:.|.|...:|        
 Frog   220 SQFPENIKVAQLLVNIQGQTFALVPQLVQSSNLSSKFVRIAPVPIAAKPVGPGGGIQGQAGVMIG 284

  Fly   187 --MSENAAGE--RGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARH 247
              ..:|.|.|  :.:.|||..|.|:|.|.:|||||||||.||||:.|:||.|.|||||||||:||
 Frog   285 QKFQKNPATELIKMHKCTFPGCTKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRH 349

  Fly   248 KRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLAASRAGR 291
            :|||||||||:|..|.|.|||||||:||.|||  |...:||:.|
 Frog   350 RRSHSGVKPYQCAVCEKKFARSDHLSKHIKVH--RFPRSSRSTR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 56/78 (72%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 16/21 (76%)
zf-H2C2_2 243..268 CDD:290200 17/24 (71%)
C2H2 Zn finger 259..279 CDD:275368 13/19 (68%)
klf15XP_002938279.1 SFP1 <284..379 CDD:227516 59/94 (63%)
C2H2 Zn finger 301..323 CDD:275368 14/21 (67%)
C2H2 Zn finger 331..353 CDD:275368 16/21 (76%)
zf-H2C2_2 345..370 CDD:372612 17/24 (71%)
C2H2 Zn finger 361..381 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48965
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 1 1.000 - - X4659
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.