DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and ZNF737

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	XP_005259754.1	Gene:	ZNF737 / 100129842	HGNCID:	32468	Length:	551	Species:	Homo sapiens

Alignment Length:	88	Identity:	39/88 - (44%)
Similarity:	48/88 - (54%)	Gaps:	4/88 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   192 AGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKP 256
            :||:.|.|.  .|.|.:..|:.|..|.|.|.|||||.|.  :|...|.....|..||..|||.||
Human   308 SGEKPYKCE--ECGKAFKHPSVLTTHKRIHTGEKPYKCE--ECGRAFKYFSSLTTHKIIHSGEKP 368

  Fly   257 YKCDYCSKCFARSDHLTKHRKVH 279
            |||:.|.|.|..|.|||.|:::|
Human   369 YKCEECGKAFNWSSHLTTHKRIH 391

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	35/78 (45%)
		C2H2 Zn finger	203..221	CDD:275368	6/17 (35%)
		C2H2 Zn finger	229..251	CDD:275368	6/21 (29%)
		zf-H2C2_2	243..268	CDD:290200	14/24 (58%)
		C2H2 Zn finger	259..279	CDD:275368	9/19 (47%)
ZNF737	XP_005259754.1	KRAB	4..62	CDD:214630
		KRAB	6..43	CDD:279668
		COG5048	143..528	CDD:227381	39/88 (44%)
		zf-H2C2_2	159..184	CDD:290200
		C2H2 Zn finger	175..195	CDD:275368
		zf-H2C2_2	188..211	CDD:290200
		C2H2 Zn finger	203..223	CDD:275368
		zf-H2C2_2	215..240	CDD:290200
		C2H2 Zn finger	231..251	CDD:275368
		zf-H2C2_2	243..268	CDD:290200
		C2H2 Zn finger	259..279	CDD:275368
		zf-H2C2_2	271..296	CDD:290200
		C2H2 Zn finger	287..307	CDD:275368
		zf-H2C2_2	300..324	CDD:290200	6/17 (35%)
		C2H2 Zn finger	315..335	CDD:275368	7/21 (33%)
		zf-H2C2_2	328..352	CDD:290200	12/25 (48%)
		C2H2 Zn finger	343..363	CDD:275368	6/21 (29%)
		zf-H2C2_2	355..379	CDD:290200	13/23 (57%)
		C2H2 Zn finger	371..391	CDD:275368	9/19 (47%)
		zf-H2C2_2	383..408	CDD:290200	5/9 (56%)
		C2H2 Zn finger	399..419	CDD:275368
		C2H2 Zn finger	427..447	CDD:275368
		zf-H2C2_2	440..464	CDD:290200
		C2H2 Zn finger	455..475	CDD:275368
		zf-H2C2_2	467..492	CDD:290200
		C2H2 Zn finger	483..503	CDD:275368
		zf-H2C2_2	496..520	CDD:290200
		C2H2 Zn finger	511..529	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000