DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf15 and klf12b

DIOPT Version :9

Sequence 1:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster
Sequence 2:	NP_001103335.1	Gene:	klf12b / 100126139	ZFINID:	ZDB-GENE-071004-22	Length:	341	Species:	Danio rerio

Alignment Length:	111	Identity:	56/111 - (50%)
Similarity:	72/111 - (64%)	Gaps:	3/111 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   171 DSASP--AEAVAPPSALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPD 233
            ||.||  .|::..|...: |.::...|.:.|.|..|.|:|.|.:|||||.|.|.|||||.|:|..
Zfish   229 DSMSPFSIESIRRPPPPE-SPDSKKRRIHRCDFAGCNKVYTKSSHLKAHRRTHTGEKPYKCTWDG 292

  Fly   234 CVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279
            |.|:|:|||||.||.|.|:||||:||..|.:.|:|||||..||:.|
Zfish   293 CTWKFARSDELTRHYRKHTGVKPFKCGDCDRSFSRSDHLALHRRRH 338

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	47/78 (60%)
		C2H2 Zn finger	203..221	CDD:275368	10/17 (59%)
		C2H2 Zn finger	229..251	CDD:275368	13/21 (62%)
		zf-H2C2_2	243..268	CDD:290200	14/24 (58%)
		C2H2 Zn finger	259..279	CDD:275368	10/19 (53%)
klf12b	NP_001103335.1	zf-C2H2	256..280	CDD:278523	12/23 (52%)
		C2H2 Zn finger	258..280	CDD:275368	12/21 (57%)
		zf-H2C2_2	272..>289	CDD:290200	12/16 (75%)
		C2H2 Zn finger	288..310	CDD:275368	13/21 (62%)
		zf-H2C2_2	302..327	CDD:290200	14/24 (58%)
		C2H2 Zn finger	318..338	CDD:275368	10/19 (53%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910