DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klf15 and klf5a

DIOPT Version :9

Sequence 1:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_001344916.5 Gene:klf5a / 100006043 ZFINID:ZDB-GENE-090312-167 Length:429 Species:Danio rerio


Alignment Length:304 Identity:86/304 - (28%)
Similarity:129/304 - (42%) Gaps:90/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EFDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNNNTNTNGNIQVGLPHVEDPSLFIDFNDLTV 99
            :|.|.:...|.||.             |:..:|.:........:| |....:|..||        
Zfish   157 DFTSIFNSNSTSGS-------------GMDVVDDSAGVFVKQEMQ-GFDIPQDGPLF-------- 199

  Fly   100 CPPDLSDWEQRLLDNYVEIPDLVD--------------FLPERT-------------PLCTDNCA 137
                      :||::.:::||..|              ...::|             ||...:..
Zfish   200 ----------QLLNSELDVPDPTDPHAHSQMPTFHNLHLAAQQTAAKSYCGMAAHGYPLSHGHFV 254

  Fly   138 DFLEESNSNLRLS----GPPHSEIFVPDRSSS-----SPGSSDSASPAEAVA------------- 180
            ...::::|.|:::    .||.||...|||...     :|..|.:|:.|..:|             
Zfish   255 HPQDQAHSQLKMTYLPPSPPTSEPGSPDRQKELLHNLTPPPSYAATIASKMAGHAPSHPTPASAR 319

  Fly   181 PPSAL---------QMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVW 236
            ||:..         :.:.:....|.:.|.|..|:|:|.|.:|||||||.|.|||||.|:|..|.|
Zfish   320 PPTTTGSMPVRYNRRTNPDLEKRRIHHCDFPGCKKVYTKSSHLKAHLRTHTGEKPYRCTWEGCDW 384

  Fly   237 RFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHE 280
            ||:|||||.||.|.|:|.||::|..||:.|:|||||..|.|.|:
Zfish   385 RFARSDELTRHFRKHTGAKPFQCAVCSRSFSRSDHLALHMKRHQ 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 47/78 (60%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)
klf5aXP_001344916.5 COG5048 322..>408 CDD:227381 38/85 (45%)
C2H2 Zn finger 350..369 CDD:275368 11/18 (61%)
zf-H2C2_2 361..>378 CDD:290200 13/16 (81%)
C2H2 Zn finger 377..399 CDD:275368 14/21 (67%)
zf-H2C2_2 391..416 CDD:290200 13/24 (54%)
C2H2 Zn finger 407..427 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4706
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.