DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15472 and CG12923

DIOPT Version :9

Sequence 1:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001260840.1 Gene:CG12923 / 36026 FlyBaseID:FBgn0033461 Length:323 Species:Drosophila melanogaster


Alignment Length:284 Identity:52/284 - (18%)
Similarity:96/284 - (33%) Gaps:99/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QCPIEKCISTVFKDDMLQHLAQRHFRSN--------VKKHLQVAFNGERCTLVFDVSQLIGTQTI 90
            :|..|.|...:....:|.|....|....        |.||       ||..|.|..:........
  Fly   115 KCLFEGCQRRIDSQLLLLHYLCDHENKEASFQRFLPVVKH-------ERAVLSFKPTSCKNPDNQ 172

  Fly    91 CLGVLLYGGVRGKHSQLPGEREFCYHNR--LKEDSGLESLKDYLPIMVLVKRT---TFLCWALVD 150
            .||:|.|..    ...|..:|:...:|.  |.:.|.|:|   ::|::||:.:|   |    ||.:
  Fly   173 VLGLLAYNA----QQLLISQRQCEPYNSFPLNQHSHLDS---HIPLVVLISQTLPNT----ALRN 226

  Fly   151 RKMESQEDLNGKQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQKNNDLKTTTEAEQEEIMDSD 215
            |:                       |.|:|               :|::                
  Fly   227 RR-----------------------SPDSH---------------RNSE---------------- 237

  Fly   216 ILIIWTQSAPCIRPLHVAMTVFNSTLSVGRS---AMRCVANS--GQMYTEIGGKDLPKDRHSLLI 275
             .::|..:......|:|.::::...:::..|   .:|.|.|:  ...|..:       |.....:
  Fly   238 -FVLWLVTPSDGLQLNVTLSLYGRDVALRTSCVLGVRKVNNNRDADYYMAV-------DESYWRL 294

  Fly   276 TQQELKEIC-GAEHHLHLELILHE 298
            |..|::::. .....||||:::.|
  Fly   295 TYAEVEKLSNNFRDELHLEVVVTE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 47/267 (18%)
CG12923NP_001260840.1 DUF4729 115..313 CDD:292491 49/277 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.