DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15472 and CG15482

DIOPT Version :9

Sequence 1:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_609614.2 Gene:CG15482 / 34717 FlyBaseID:FBgn0032483 Length:309 Species:Drosophila melanogaster


Alignment Length:260 Identity:58/260 - (22%)
Similarity:87/260 - (33%) Gaps:71/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSSTEPEKQTKLTLNHLCQLPAQ------------------------CPIEKCISTVFKDDMLQH 52
            :::..||.|..|.|.:...|..|                        ||...|:.:|....:|.|
  Fly    60 VAAPAPEDQLLLKLQNFESLTEQPSSSRKSTATTSSDSPWSRLRLVACPCHGCLCSVDPSALLGH 124

  Fly    53 LAQRHFRSNVKKHLQVAF----NGERCTLVFDVSQLIGTQTICLGVLLYGGVR--------GKHS 105
            ....|...     :.|.|    .|:|.:|...:|.|.......|||  ||..|        .:::
  Fly   125 YLSDHLPG-----MGVPFYELEMGKRVSLTCHISSLERDVNTLLGV--YGYRRTGLNPLKCHRNT 182

  Fly   106 QLPGE-REFCYHNRLKEDSGLESLKDYLPIMVLVKRTTFLCW--------ALVDRKMESQEDLNG 161
            .||.| |.|..|:.|. .....::...|.....||......|        |:..|.:....:|..
  Fly   183 HLPVEYRRFSQHSALM-IFACRTMHSVLWERKRVKHEVLAIWVATPLHGVAITLRLLVQPANLPR 246

  Fly   162 KQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQ---KNNDLKTTTEAEQEEIMDSDILIIWTQS 223
            ..::.:|....|..|  ::..|||  ..:.||..   ..|||:        .:||.|   :|.||
  Fly   247 YYTRQIKARPMLPLS--SNQSCSE--FIKTDSNVILISLNDLR--------PLMDLD---VWQQS 296

  Fly   224  223
              Fly   297  296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 52/239 (22%)
CG15482NP_609614.2 DUF4729 105..300 CDD:292491 51/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.