DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15472 and CG11227

DIOPT Version :9

Sequence 1:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_728371.1 Gene:CG11227 / 33071 FlyBaseID:FBgn0031139 Length:764 Species:Drosophila melanogaster


Alignment Length:284 Identity:66/284 - (23%)
Similarity:102/284 - (35%) Gaps:97/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CPI--EKCISTVFKDDMLQHLAQRHFRSNVKKHLQVAFNGERCTLVFDVSQLIGTQTICLGVLLY 97
            ||:  ::| ..|..|.:|.|...||. ....|.|:..|.||:..::|........:|.|:.||.|
  Fly   553 CPLNNDEC-PAVMNDTLLAHFVSRHL-DEPGKELREIFEGEQMLMIFSPRAFQLAKTECISVLGY 615

  Fly    98 GGVRGKHSQLPGEREFCYHNRLKEDSGLESLKD----YLPIMVLVKRTTFLCWALVDRKMESQED 158
            ||||.|...||..|..     |..:|||....|    :||::|::.|...   ..|:.:.|..|.
  Fly   616 GGVRNKPCTLPAVRFM-----LTPNSGLPEAYDHFDGHLPLLVMICRNPM---GTVEGRKERFEG 672

  Fly   159 LNGKQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQKNNDLKTTTEAEQEEIMDSDILIIW--T 221
            |.                                                    |.|.|.:|  :
  Fly   673 LE----------------------------------------------------DEDTLALWMVS 685

  Fly   222 QSAPCIRPLHVAMTVFNSTLSVGRSAMRCVAN------------SGQMYTEIGGKDLPKDRHSLL 274
            :..||  |:||||||.:..|.:.||::..|..            |.:.|..:       ..|.|.
  Fly   686 RDLPC--PIHVAMTVLSRRLDITRSSIMKVRGLHKSQDPLDFMLSNKNYMRL-------SNHDLR 741

  Fly   275 ITQQELKEICGAEHHLHLELILHE 298
            :...:.:|      .::||:::.|
  Fly   742 VLTNDHRE------PIYLEIVVKE 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 63/268 (24%)
CG11227NP_728371.1 DUF4729 551..754 CDD:292491 63/277 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.