DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15472 and CG1314

DIOPT Version :9

Sequence 1:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_608411.2 Gene:CG1314 / 33066 FlyBaseID:FBgn0031134 Length:378 Species:Drosophila melanogaster


Alignment Length:273 Identity:46/273 - (16%)
Similarity:83/273 - (30%) Gaps:113/273 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LCQLPAQCPIEKCISTVFKDDMLQHLAQRHFRSNVKKHLQVAFNGERCTLVF-----DVSQLIGT 87
            |.:|...||:..|......:.:|.|....|      :|:        .|:..     .|.:|.|.
  Fly   136 LQKLDMACPLSNCDLMFNPEQLLSHCLMHH------EHI--------ITMEMKPKEPKVLKLCGK 186

  Fly    88 -------QTICLGVLLY--GGVRGKHSQLPGEREFCYHNRLKEDSGLESLKDY---LPIMVLVKR 140
                   ::.|:|:::|  |....::..||                 ...||:   ||:::::.:
  Fly   187 SLPEDRGKSNCVGLMIYESGNNATRNLNLP-----------------NIYKDWECQLPVLIMLWK 234

  Fly   141 TTFLCWALVDRKMESQEDLNGKQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQKNNDLKTTTE 205
            |:   |.                            |....|:.:.                    
  Fly   235 TS---WD----------------------------SMPVGPRVTH-------------------- 248

  Fly   206 AEQEEIMDSDILIIWTQSAPCIRPLHVAMTVFNSTLSVGRSAMRCVANSGQMYTEIGGKDLPKDR 270
                      |.|:|........||.|::.:..:|..|.|   |.:..:.|....:...||..|.
  Fly   249 ----------IYILWLCCPQAQTPLLVSVNIGENTPGVPR---RQMIQTCQGSETLKNCDLLSDS 300

  Fly   271 -HSLLITQQELKE 282
             |.:..|.:|:||
  Fly   301 PHFMRFTHREMKE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 44/268 (16%)
CG1314NP_608411.2 DUF4729 142..319 CDD:292491 44/267 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.