DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15472 and CG12682

DIOPT Version :9

Sequence 1:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_572190.1 Gene:CG12682 / 31415 FlyBaseID:FBgn0029729 Length:237 Species:Drosophila melanogaster


Alignment Length:282 Identity:64/282 - (22%)
Similarity:104/282 - (36%) Gaps:83/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PAQCPIEKCISTVFKDDMLQHLAQRHFRSNVKK-----HLQVAFNGERCTLVFDVSQLIGTQTIC 91
            ||.||:..|.:.|....:|:|:..:|.....:.     .|:....|:|..|:....|||.....|
  Fly    17 PAICPLADCQAVVEHTHLLRHMITKHLDPRARTLPFQLRLREVSTGQRTLLMLPYRQLIIDNDQC 81

  Fly    92 LGVLLY-----GGVRGKHSQLPGEREFCYHNRLKEDSGLESLKDYLPIMVLVKRTTFLCWALVDR 151
            |.||.:     |.:......||.    |:          :.|..:|||:|:|.|||   |..:  
  Fly    82 LAVLNWSSVSQGDLTAPQLDLPP----CH----------QMLTYHLPILVMVCRTT---WKSL-- 127

  Fly   152 KMESQEDLNGKQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQKNNDLKTTTEAEQEEIMDSDI 216
                           |||:...|.                   |:..|:  |.|.       ..:
  Fly   128 ---------------LKQIDEKDM-------------------QETRDV--TAEW-------GGV 149

  Fly   217 LIIWTQSAPCIRPLHVAMTVFNSTL-SVGRSAMRCVAN-SGQMYTE--IGGKDLPKDRHSLLITQ 277
            .:.|..|....||::..:.:.||.: ||.|...|.:.| :.:|...  |.|    .|.:.:.|.:
  Fly   150 YLFWLLSPLTRRPIYANLALLNSQIQSVYRRNRRRIRNFASRMPIRQFING----LDPYFVSINE 210

  Fly   278 QELKEIC---GAEHHLHLELIL 296
            .:|.|:|   |....::.|:|:
  Fly   211 DQLDELCNGGGNRFSIYFEVII 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 59/264 (22%)
CG12682NP_572190.1 DUF4729 20..222 CDD:292491 59/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.