DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Proc-R and Gpr142

DIOPT Version :9

Sequence 1:	NP_001014723.1	Gene:	Proc-R / 31408	FlyBaseID:	FBgn0029723	Length:	545	Species:	Drosophila melanogaster
Sequence 2:	XP_038943713.1	Gene:	Gpr142 / 501735	RGDID:	1559926	Length:	348	Species:	Rattus norvegicus

Alignment Length:	102	Identity:	31/102 - (30%)
Similarity:	58/102 - (56%)	Gaps:	5/102 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   393 LTNASSIRRTKRKSNSGLKGSVSQENRVTITLIAVVLMFIVCQLPWAIYLIVNQYM-EIQIGTQV 456
            :||::.|.|.:::...||:..:|:.   |..|:.|..:|.:...|....::.:.|: .:....:|
  Rat   221 VTNSAIILRLRKRGQRGLQPWMSKS---TAILLGVTSLFALLWAPRISVMLYHLYVAPVHRDWRV 282

  Fly   457 -VAGNVCNLLASLHAASNFFLYCVLSDKYRKTVRELI 492
             :|.::.|:||.|:.|.||.|||.:|..:|.|||::|
  Rat   283 HLALDIANMLAMLNTAVNFGLYCFISKTFRATVRQVI 319

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Proc-R	NP_001014723.1	7tm_4	52..>183	CDD:304433
Gpr142	XP_038943713.1	7tm_GPCRs	47..315	CDD:421689	27/96 (28%)
		TM helix 1	48..74	CDD:410628
		TM helix 2	82..107	CDD:410628
		TM helix 3	121..151	CDD:410628
		TM helix 4	163..183	CDD:410628
		TM helix 5	200..225	CDD:410628	2/3 (67%)
		TM helix 6	240..272	CDD:410628	6/34 (18%)
		TM helix 7	283..308	CDD:410628	11/24 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D421120at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920