DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Proc-R and CG15614

DIOPT Version :9

Sequence 1:NP_001014723.1 Gene:Proc-R / 31408 FlyBaseID:FBgn0029723 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_611168.2 Gene:CG15614 / 36899 FlyBaseID:FBgn0034168 Length:469 Species:Drosophila melanogaster


Alignment Length:143 Identity:44/143 - (30%)
Similarity:62/143 - (43%) Gaps:25/143 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VRHVVQRILVPCVFVIGLLGNSVSIYVLTRKRMRCTTNIYLTALAITDIAYLTCQLI----LSLQ 98
            |..|:..:.||.:...||..|.::..|..|.:|..:...||.||:..|.  ::|.||    ||..
  Fly    37 VLFVLYGLAVPTLSAFGLCTNFINAVVFMRPKMTPSAFSYLAALSWMDC--ISCLLITMTALSRS 99

  Fly    99 H-YDYPKYHFKLYWQLYGYFVWLCDSFGYISI----YIAVCFTIERFIAIRYPLKRQT----FCT 154
            : |..|.      |..|.| .|....|| ||.    .|..|.:::|||.:.. .||..    ||.
  Fly   100 YFYSSPT------WITYDY-QWQTPLFG-ISTGGANLILACLSLDRFIYLSC-FKRNNGAPRFCR 155

  Fly   155 ESLAKKVIAAVAI 167
            ..:|:.:| .|||
  Fly   156 RKVARCII-VVAI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Proc-RNP_001014723.1 7tm_4 52..>183 CDD:304433 40/129 (31%)
CG15614NP_611168.2 7tm_4 48..>242 CDD:304433 40/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46641
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.