Sequence 1: | NP_001014723.1 | Gene: | Proc-R / 31408 | FlyBaseID: | FBgn0029723 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504895.2 | Gene: | srx-60 / 187858 | WormBaseID: | WBGene00005951 | Length: | 300 | Species: | Caenorhabditis elegans |
Alignment Length: | 132 | Identity: | 33/132 - (25%) |
---|---|---|---|
Similarity: | 58/132 - (43%) | Gaps: | 21/132 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 LVPCVFVIGLLGNSVSIYVLTRKRMRCTTNI--YLTA-LAITD----IAYLT--CQLILSLQHYD 101
Fly 102 YPKYHFKLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVA 166
Fly 167 IF 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Proc-R | NP_001014723.1 | 7tm_4 | 52..>183 | CDD:304433 | 30/126 (24%) |
srx-60 | NP_504895.2 | TM helix 1 | 8..31 | CDD:381740 | 6/22 (27%) |
7TM_GPCR_Srx | 12..266 | CDD:370981 | 32/131 (24%) | ||
TM helix 2 | 40..62 | CDD:381740 | 8/21 (38%) | ||
TM helix 3 | 77..99 | CDD:381740 | 3/24 (13%) | ||
TM helix 4 | 122..147 | CDD:381740 | 3/9 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D421120at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |