DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Proc-R and srx-60

DIOPT Version :9

Sequence 1:NP_001014723.1 Gene:Proc-R / 31408 FlyBaseID:FBgn0029723 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_504895.2 Gene:srx-60 / 187858 WormBaseID:WBGene00005951 Length:300 Species:Caenorhabditis elegans


Alignment Length:132 Identity:33/132 - (25%)
Similarity:58/132 - (43%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LVPCVFVIGLLGNSVSIYVLTRKRMRCTTNI--YLTA-LAITD----IAYLT--CQLILSLQHYD 101
            |:|..|:..:|..|:.|.:.   ::....|.  |||| .||.|    :.:|.  |.:::    .|
 Worm    11 LIPITFIGSVLNFSILIAIY---KLPALNNSFGYLTANQAIVDALHSVIFLLYFCPMVI----LD 68

  Fly   102 YPKYHFKLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVA 166
            .|  ..|.|..:.|.|:..|.....::.::   .:|.||.|:..|||.:.:.:......:|..:.
 Worm    69 QP--IMKSYSFIVGCFLLFCYELSVLTHFL---ISINRFCAVWVPLKYEKWFSRKNTSSIIILLW 128

  Fly   167 IF 168
            ||
 Worm   129 IF 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Proc-RNP_001014723.1 7tm_4 52..>183 CDD:304433 30/126 (24%)
srx-60NP_504895.2 TM helix 1 8..31 CDD:381740 6/22 (27%)
7TM_GPCR_Srx 12..266 CDD:370981 32/131 (24%)
TM helix 2 40..62 CDD:381740 8/21 (38%)
TM helix 3 77..99 CDD:381740 3/24 (13%)
TM helix 4 122..147 CDD:381740 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.