DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Proc-R and H23L24.4

DIOPT Version :10

Sequence 1:NP_572183.1 Gene:Proc-R / 31408 FlyBaseID:FBgn0029723 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_501495.2 Gene:H23L24.4 / 186764 WormBaseID:WBGene00019231 Length:356 Species:Caenorhabditis elegans


Alignment Length:191 Identity:50/191 - (26%)
Similarity:85/191 - (44%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 SLLQL------WRRKRSAENHNINNTDAFAFNVTEYCQNVTYYNHGLSELGYDELYSYLWN--LF 359
            ||:.|      |...|...:|:..|:..:.:.:.          |..|:|..:|.|..:.:  |:
 Worm   144 SLMALMFNGCKWAEFRWFWSHDPTNSSDYQYILA----------HEPSDLARNENYHRVLDNLLY 198

  Fly   360 TLLVFVVFPLLLLATFNSILILLVHRSKNLRGDLTNASSIRRTKRKSNSGLKGSVSQENRVTITL 424
            .|||::| |||||:..|..:             |:|.|:     |:.:...|...:||.|....|
 Worm   199 PLLVYLV-PLLLLSVLNFRI-------------LSNISN-----RRVSFDHKSRFAQERRSVTLL 244

  Fly   425 IAVVLMFIVCQLPWAIYLIVNQYMEIQIGTQVVAGNVCNLLASLHAASNFFLYCVLSDKYR 485
            |::|.||.:|......|..|:|.........|:..:|.|||.::::.:|..||.|.:.::|
 Worm   245 ISIVTMFFLCHTGGLAYRFVDQEKYNNSELFVLLKDVINLLFNVYSFTNPLLYFVFTRQFR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Proc-RNP_572183.1 7tmA_FMRFamide_R-like 41..488 CDD:410630 50/191 (26%)
TM helix 1 42..68 CDD:410630
TM helix 2 74..99 CDD:410630
TM helix 3 114..144 CDD:410630
TM helix 4 156..176 CDD:410630
TM helix 5 351..378 CDD:410630 12/28 (43%)
TM helix 6 415..445 CDD:410630 10/29 (34%)
TM helix 7 456..481 CDD:410630 9/24 (38%)
H23L24.4NP_501495.2 7tm_GPCRs 24..306 CDD:475119 50/191 (26%)
TM helix 2 49..70 CDD:410628
TM helix 3 95..117 CDD:410628
TM helix 4 138..159 CDD:410628 4/14 (29%)
TM helix 5 192..215 CDD:410628 10/23 (43%)
TM helix 6 241..263 CDD:410628 7/21 (33%)
TM helix 7 276..301 CDD:410628 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.