DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Proc-R and Vmn1r-ps103

DIOPT Version :9

Sequence 1:NP_001014723.1 Gene:Proc-R / 31408 FlyBaseID:FBgn0029723 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_598972.2 Gene:Vmn1r-ps103 / 171245 MGIID:2159658 Length:323 Species:Mus musculus


Alignment Length:255 Identity:50/255 - (19%)
Similarity:86/255 - (33%) Gaps:99/255 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 SGSSNQLVDWGSGSGDGEPENIPRH--RRHWQSSGFVTLPT-----------LRKTLEEQDQKVA 292
            |.|.|.::.|.     |.||..|.|  ..|...:..:.|.|           :|..|::...|:.
Mouse    68 SVSVNFMLSWW-----GSPEKKPIHLILIHLAFTNIILLLTKGLPKAIETFGIRNFLDDIGCKII 127

  Fly   293 DAAQR-----SGVTESLLQL------------WRRKR--SAEN--------------------HN 318
            ....|     |..|.|||.:            |||.|  ||::                    |:
Mouse   128 VYLGRVARGLSLCTSSLLTVVQAIIISPRASGWRRLRPKSAQHILPFLLFFWILNGLISMNLIHS 192

  Fly   319 INNTDAFAFNVTEY--CQNVTYYNHGLSELGYDELYSYLWNLFTLLVFVVFPLLLL--ATF---- 375
            |.:|   ..|::::  ..|..|:.....|:.:                :|.||::|  |.|    
Mouse   193 IIST---GMNISQHKNSDNYCYFMQESQEIKW----------------IVLPLMVLRDAVFQGAM 238

  Fly   376 ---NSILILLVHRSKNLRGDLTNASSIRRTKRKSNSGLKGSVSQENRVTITLIAVVLMFI 432
               :..::.|:|:.......|.|:..:.||            ..|.|...:::.::|.|:
Mouse   239 GGASGYMVFLLHKHHQQVLYLQNSKLLYRT------------PPELRAAQSVLLLMLCFV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Proc-RNP_001014723.1 7tm_4 52..>183 CDD:304433
Vmn1r-ps103NP_598972.2 V1R 79..298 CDD:112227 46/239 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.