Sequence 1: | NP_001014723.1 | Gene: | Proc-R / 31408 | FlyBaseID: | FBgn0029723 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598972.2 | Gene: | Vmn1r-ps103 / 171245 | MGIID: | 2159658 | Length: | 323 | Species: | Mus musculus |
Alignment Length: | 255 | Identity: | 50/255 - (19%) |
---|---|---|---|
Similarity: | 86/255 - (33%) | Gaps: | 99/255 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 241 SGSSNQLVDWGSGSGDGEPENIPRH--RRHWQSSGFVTLPT-----------LRKTLEEQDQKVA 292
Fly 293 DAAQR-----SGVTESLLQL------------WRRKR--SAEN--------------------HN 318
Fly 319 INNTDAFAFNVTEY--CQNVTYYNHGLSELGYDELYSYLWNLFTLLVFVVFPLLLL--ATF---- 375
Fly 376 ---NSILILLVHRSKNLRGDLTNASSIRRTKRKSNSGLKGSVSQENRVTITLIAVVLMFI 432 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Proc-R | NP_001014723.1 | 7tm_4 | 52..>183 | CDD:304433 | |
Vmn1r-ps103 | NP_598972.2 | V1R | 79..298 | CDD:112227 | 46/239 (19%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D421120at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |