DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7024 and PRS5

DIOPT Version :9

Sequence 1:NP_572182.1 Gene:CG7024 / 31407 FlyBaseID:FBgn0029722 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_014580.1 Gene:PRS5 / 854093 SGDID:S000005422 Length:496 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:42/216 - (19%)
Similarity:70/216 - (32%) Gaps:82/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 MHMYSDKFYGGNG-------------IVGAQVPLG------AGIGLAHSYRKDNGVSVVLYGDGA 200
            |.|.:...:||:.             |..::|.||      ..|.|..|.|:.:   |.:...|.
Yeast     1 MSMSNIVVFGGDSHPELVTKICENLDIHPSKVELGKFSNGETNIALRESVREKD---VYIIQSGC 62

  Fly   201 ANQGQIFESFNMAKLWCLPCIFVCENNHYGMGTHVKRASAMTEF--YMRGQYIPGLWVDGNQVLA 263
               ||:.::|    :..|..|..|::      ....|.:|:..:  |.|...||           
Yeast    63 ---GQVNDTF----MQLLILISACKS------ASASRVTAVMPYLCYSRQPDIP----------- 103

  Fly   264 VRSATQFAVDHALKHGPIVLE-MSTYRYVGHSMSDPGTSYRSREEVQSTREKRDPITSFRSQIIA 327
                      :..|..||:.: ...|.:..|    |||                |::   |.::.
Yeast   104 ----------YTAKGAPIISKPKENYTFESH----PGT----------------PVS---SSLMT 135

  Fly   328 LCLADEEELKALDDKTRKQVD 348
            .....|..||:||...|..::
Yeast   136 QRPGAESSLKSLDSAIRSTIN 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7024NP_572182.1 TPP_enzymes 37..381 CDD:294952 42/216 (19%)
PRS5NP_014580.1 PrsA 2..493 CDD:223538 41/215 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.