DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7024 and Prpsap1

DIOPT Version :9

Sequence 1:NP_572182.1 Gene:CG7024 / 31407 FlyBaseID:FBgn0029722 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_006534080.1 Gene:Prpsap1 / 67763 MGIID:1915013 Length:390 Species:Mus musculus


Alignment Length:229 Identity:50/229 - (21%)
Similarity:79/229 - (34%) Gaps:64/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LGAGIGLAHSYRKDNGVSVVLYGDGAANQG----QIFESF------NMAKLWCLPCIF----VCE 225
            |||.:|.:..|::.||.:.|...:....|.    |...||      |.|.:..|...:    .|.
Mouse    59 LGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPSFYCFRDVNTAVMELLIMAYALKTACA 123

  Fly   226 NNHYGMGTHVKRASAMTEFYMRGQYIPGLWVDGNQVLAVRSAT----------------QFAVDH 274
            .|..|:..:.. .|..::...||..:..|..   .:||....|                .|.||:
Mouse   124 RNIIGVIPYFP-YSKQSKMRKRGSIVCKLLA---SMLAKAGLTHIITMDLHQKEIQGFFSFPVDN 184

  Fly   275 ALKHGPIVLEMSTYRYVGHSMSDPGTSYRSREEVQSTRE----KRDPITSFRSQIIA----LCLA 331
             |:..|.:|:     |:             :||:.:.|.    .:.|..:.|:|..|    |.||
Mouse   185 -LRASPFLLQ-----YI-------------QEEIPNYRNAVIVAKSPDAAKRAQSYAERLRLGLA 230

  Fly   332 ---DEEELKALDDKTRKQVDSICKKATTDREVEL 362
               .|.:...||....:....:.|.||....:||
Mouse   231 VIHGEAQCTELDMDDGRHSPPMVKNATVHPGLEL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7024NP_572182.1 TPP_enzymes 37..381 CDD:294952 50/229 (22%)
Prpsap1XP_006534080.1 Pribosyltran_N 38..160 CDD:379372 24/104 (23%)
Pribosyl_synth 201..384 CDD:373138 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.