DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7024 and Prps

DIOPT Version :9

Sequence 1:NP_572182.1 Gene:CG7024 / 31407 FlyBaseID:FBgn0029722 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_729528.2 Gene:Prps / 39132 FlyBaseID:FBgn0036030 Length:388 Species:Drosophila melanogaster


Alignment Length:104 Identity:24/104 - (23%)
Similarity:39/104 - (37%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 HTDIYAKNVD------GKIRGVSGFHLEH-IKLAEVCFGKP---KKTPASEIND------VPVGA 414
            |.|:..:.||      ||:......:||. :::.|...|:.   .::.:.||||      :.:.|
  Fly    59 HPDLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIMINA 123

  Fly   415 EIDVAKAKE--------RKAKQDAKKAKEAKEPKGGDKK 445
             ..:|.|..        ..|:||.|......|.....||
  Fly   124 -CKIASASRVTAVIPCFPYARQDKKDKLAGSEDNAESKK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7024NP_572182.1 TPP_enzymes 37..381 CDD:294952 6/20 (30%)
PrpsNP_729528.2 PrsA 48..383 CDD:223538 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.