DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7024 and PRPS1L1

DIOPT Version :9

Sequence 1:NP_572182.1 Gene:CG7024 / 31407 FlyBaseID:FBgn0029722 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_787082.1 Gene:PRPS1L1 / 221823 HGNCID:9463 Length:318 Species:Homo sapiens


Alignment Length:127 Identity:23/127 - (18%)
Similarity:40/127 - (31%) Gaps:40/127 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 GGNGIVGAQVPLGAGIGLAHSYRKD-NGVS-VVLYGDGAANQGQIFESFNMAKLWCLPCIFVCEN 226
            |...:......|.....|.|..||. |.|. :||.||  .|........:||.    .|:.:|  
Human   174 GAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGD--VNDRVAILVDDMAD----TCVTIC-- 230

  Fly   227 NHYGMGTHVKRASAMTEFYMRGQYIPGLWVDGNQVLAVRSATQFAV-DHALKHGPIVLEMST 287
                                         :..:::|:..:...:|: .|.:..||.:..::|
Human   231 -----------------------------LAADKLLSAGATRVYAILTHGIFSGPAISRINT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7024NP_572182.1 TPP_enzymes 37..381 CDD:294952 23/127 (18%)
PRPS1L1NP_787082.1 PrsA 1..313 CDD:223538 23/127 (18%)
Pribosyltran_N 4..120 CDD:290508
PRTases_typeI 161..313 CDD:294217 23/127 (18%)
Binding of phosphoribosylpyrophosphate. /evidence=ECO:0000255 212..227 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.