DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7024 and Pdha1

DIOPT Version :9

Sequence 1:NP_572182.1 Gene:CG7024 / 31407 FlyBaseID:FBgn0029722 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_032836.1 Gene:Pdha1 / 18597 MGIID:97532 Length:390 Species:Mus musculus


Alignment Length:354 Identity:186/354 - (52%)
Similarity:240/354 - (67%) Gaps:7/354 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KC--YDLENGPTMDVELSREDALTMYTQMLELRRFETVAGNYYKERKIRGFCHLYNGQEAVAVGM 106
            ||  :.||.||.:...|:|||.|..|..|..:||.|..|...||::.|||||||.:||||..||:
Mouse    40 KCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGL 104

  Fly   107 KQRLRSCDSVITAYRCHAWTYLMGVSLYEIMAELFGVRTGCSRGKGGSMHMYSDKFYGGNGIVGA 171
            :..:...|.:|||||.|.:|:..|:.:..|:|||.|.|.||::|||||||||:..||||||||||
Mouse   105 EAGINPTDHLITAYRAHGFTFTRGLPVRAILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGA 169

  Fly   172 QVPLGAGIGLAHSYRKDNGVSVVLYGDGAANQGQIFESFNMAKLWCLPCIFVCENNHYGMGTHVK 236
            ||||||||.||..|...:.|.:.||||||||||||||::|||.||.|||||:||||.|||||.|:
Mouse   170 QVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVE 234

  Fly   237 RASAMTEFYMRGQYIPGLWVDGNQVLAVRSATQFAVDHALK-HGPIVLEMSTYRYVGHSMSDPGT 300
            ||:|.|::|.||.:||||.|||..:|.||.||:||..:... .|||::|:.||||.||||||||.
Mouse   235 RAAASTDYYKRGDFIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGV 299

  Fly   301 SYRSREEVQSTREKRDPITSFRSQIIALCLADEEELKALDDKTRKQVDSICKKATTDREVELDEL 365
            |||:|||:|..|.|.|||...:.:::...||..||||.:|.:.||:::...:.||.|.|..|:||
Mouse   300 SYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEEL 364

  Fly   366 HTDIYAKNVDGKIRGVSGFHLEHIKLAEV 394
            ...||:.:...::||.:    :.||...|
Mouse   365 GYHIYSSDPPFEVRGAN----QWIKFKSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7024NP_572182.1 TPP_enzymes 37..381 CDD:294952 182/339 (54%)
Pdha1NP_032836.1 PDH_E1_alph_y 58..370 CDD:274473 173/311 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S510
OMA 1 1.010 - - QHG54057
OrthoDB 1 1.010 - - D318981at33208
OrthoFinder 1 1.000 - - FOG0001471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100754
Panther 1 1.100 - - LDO PTHR11516
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X926
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.670

Return to query results.
Submit another query.