DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7024 and Prpsap2

DIOPT Version :9

Sequence 1:NP_572182.1 Gene:CG7024 / 31407 FlyBaseID:FBgn0029722 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_476472.1 Gene:Prpsap2 / 117272 RGDID:620207 Length:369 Species:Rattus norvegicus


Alignment Length:118 Identity:26/118 - (22%)
Similarity:44/118 - (37%) Gaps:26/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 PITSFRSQIIALCLADEE-------ELKALDDKTRKQVDSICKKATTDREV---ELDELHTDIYA 371
            |:.:.|:....|....||       .:.|....:.|:..|..::......|   |..:..:|:  
  Rat   159 PVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDL-- 221

  Fly   372 KNVDGK-----IRGVSGFHLEHIKLAEVCFGKPK-KTPASEINDVPVGAEIDV 418
              |||:     :|.|:..|    ...|:....|| |.|.:.:.|  ||..|.:
  Rat   222 --VDGRHSPPMVRSVAAIH----PSLEIPMLIPKEKPPITVVGD--VGGRIAI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7024NP_572182.1 TPP_enzymes 37..381 CDD:294952 15/78 (19%)
Prpsap2NP_476472.1 Pribosyltran_N 20..138 CDD:404648
Pribosyl_synth 179..363 CDD:405288 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.