DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdha and PRS3

DIOPT Version :9

Sequence 1:NP_726945.1 Gene:Pdha / 31406 FlyBaseID:FBgn0028325 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_011852.1 Gene:PRS3 / 856375 SGDID:S000001003 Length:320 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:27/123 - (21%)
Similarity:36/123 - (29%) Gaps:33/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IIVKQLQKRCHNNNNNNIIISGCRILSNNNNNSSIDIIRNGRYSSSFFGLFQNAAQAGVSKTNNY 77
            |||..:...|      ..:.....||..|...|.|.|:.:|..|.           ..:...||.
Yeast   219 IIVDDMADTC------GTLAKAAEILLENRAKSVIAIVTHGVLSG-----------RAIENINNS 266

  Fly    78 ATEATVQVNR-PFKLHRLDEGPATEVKLTKDQALKYY----TQMQTIRRLETAAGNLY 130
            ..:..|..|. ||           |.|:.|...|...    ...::||||.......|
Yeast   267 KLDRVVCTNTVPF-----------EEKIKKCPKLAVIDISSVLAESIRRLHNGESISY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhaNP_726945.1 TPP_enzymes 78..426 CDD:294952 13/58 (22%)
PRS3NP_011852.1 PrsA 4..315 CDD:223538 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.